Gene Information

Name : SULAZ_0662 (SULAZ_0662)
Accession : YP_002728647.1
Strain : Sulfurihydrogenibium azorense Az-Fu1
Genome accession: NC_012438
Putative virulence/resistance : Virulence
Product : transcriptional activator protein CopR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 596444 - 597118 bp
Length : 675 bp
Strand : -
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
ATGAAAGTACTAATCATAGAAGATGATAAAGAGCTTTCCCACCTTATAGCAAAAAGACTTAAAGAAGAAGGTTTTGCCGT
TCAGCAGGCATTTGATGCAGAAGAAGGAATGAGTTATGCTACCTATGAAGAGTACGACGTTATCGTTTTAGATATAATGC
TTCCTAAAATGTCAGGCTACGAAGTAATACGACAATTAAGAGAAAAGAAGGTTAAAACTCCTATCTTAGTTTTAAGTGCA
AAAGGAGAAATAGAAGACAAAGTGAAAGGACTACAACTTGGAGCTGATGATTACCTTACAAAACCCTTTAGCTTTCCTGA
ACTTATAGCAAGGATAAACGCCCTTATCCGTAGAACAAAAACCATAGAAGAGATATCTAAACTTAAGTATGCAGACCTTA
CAATAGATTTACTAAAAAAAGAAGTGTATCGTAATGGAAAAAAGATAAACCTTACAGCAAAAGAGTTTGAACTTCTAAAG
TACTTAGTTGAAAATTCAGAAAGAATAATTACTAGAAATATGATTTTAGAAAATGTTTTCGATATAGACTTTGATATAGA
CAGCAACGTAGTAGATGTCCACATTCATAGGTTGAGAGAAAAGATAGACAAAAGATTTGAGAAAAAACTTATTCATACAG
TTCGTGGCTTTGGTTATGTTCTCAAATCTGATTAA

Protein sequence :
MKVLIIEDDKELSHLIAKRLKEEGFAVQQAFDAEEGMSYATYEEYDVIVLDIMLPKMSGYEVIRQLREKKVKTPILVLSA
KGEIEDKVKGLQLGADDYLTKPFSFPELIARINALIRRTKTIEEISKLKYADLTIDLLKKEVYRNGKKINLTAKEFELLK
YLVENSERIITRNMILENVFDIDFDIDSNVVDVHIHRLREKIDKRFEKKLIHTVRGFGYVLKSD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-46 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-45 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR BAC0111 Protein 4e-51 48
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR BAC0197 Protein 1e-45 47
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR BAC0125 Protein 2e-50 46
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR BAC0347 Protein 2e-46 46
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR BAC0308 Protein 8e-49 45
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR BAC0083 Protein 6e-52 44
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR NC_012469.1.7686381. Protein 7e-40 44
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR BAC0638 Protein 8e-47 44
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR AF155139.2.orf0.gene Protein 6e-33 43
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR NC_002952.2859905.p0 Protein 2e-40 43
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR NC_007622.3794472.p0 Protein 2e-40 43
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR NC_002745.1124361.p0 Protein 2e-40 43
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR NC_009782.5559369.p0 Protein 2e-40 43
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR NC_002951.3237708.p0 Protein 2e-40 43
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR NC_002758.1121668.p0 Protein 2e-40 43
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR NC_009641.5332272.p0 Protein 2e-40 43
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR NC_013450.8614421.p0 Protein 2e-40 43
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR NC_007793.3914279.p0 Protein 2e-40 43
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR NC_003923.1003749.p0 Protein 3e-40 43
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR AE016830.1.gene1681. Protein 2e-38 43
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR HE999704.1.gene2815. Protein 6e-36 43
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR CP001485.1.gene721.p Protein 8e-35 42
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR HE999704.1.gene1528. Protein 9e-34 41
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR NC_012469.1.7685629. Protein 2e-30 41
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR NC_002516.2.879194.p Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR VFG0596 Protein 7e-47 46
SULAZ_0662 YP_002728647.1 transcriptional activator protein CopR VFG1390 Protein 4e-45 42