Name : rpmJ (WRi_004460) Accession : YP_002727025.1 Strain : Wolbachia sp. wRi Genome accession: NC_012416 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L36 Function : - COG functional category : - COG ID : - EC number : - Position : 477722 - 477850 bp Length : 129 bp Strand : - Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io DNA sequence : ATGAAAGTCAAAGGGTCGCTAAAATCTCATCGTAACAGAGATAAAAATTGTAAAGTTGTGAAAAGGGGTGGTAAGATTTA CATTATAAATAAGGTAAAGCCAAGGTGTAAAGCGCGTCAAGGTTCTTAG Protein sequence : MKVKGSLKSHRNRDKNCKVVKRGGKIYIINKVKPRCKARQGS |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
rpmJ | YP_001800879.1 | 50S ribosomal protein L36 | Not tested | Not named | Protein | 0.001 | 57 |