Gene Information

Name : phoB (EpC_26630)
Accession : YP_002649653.1
Strain : Erwinia pyrifoliae Ep1/96
Genome accession: NC_012214
Putative virulence/resistance : Virulence
Product : Response regulator in two-component regulatory system with PhoR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2939768 - 2940457 bp
Length : 690 bp
Strand : -
Note : silverDB:cEP02664

DNA sequence :
ATGGTAAAGCGCATTCTTGTGGTTGAAGATGAAGCCCCAATCCGTGAGATGTTGTGTTTCGTTCTGGAACAAAATGATTA
TCAACCGATAGAAGCTGCGGATTATGACCGCGCGGTTAATTTGTTGATTGAACCCTGGCCAGATTTGATTCTGCTGGACT
GGATGCTGCCCGGTGGTTCCGGAATTCAGTTTATTAAACATCTTAAGCGTGAGGCGATGACGCGCGATATCCCGGTGGTG
ATGCTGACCGCGCGTGGCGAAGAAGAAGATCGCGTGCGTGGGTTAGAAGCCGGCGCTGATGATTACATCACCAAACCTTT
CTCACCGAAGGAGCTGGTGGCACGGATTAAAGCCGTGATGCGGCGCATTTCGCCGATGGCGGTGGAAGAGGTGATTGAAA
TGCAGGGGCTGACTCTCGATCCGTCTTCACACCGCGTGATGTCAGGCAACCAGCCGCTGGATATGGGGCCAACCGAATAT
AAACTGCTGCACTTCTTTATGACGCATACGGAGCGCGTCTACAGCCGTGAGCAGTTGCTAAACCATGTCTGGGGAACTAA
CGTGTATGTCGAAGACCGCACCGTCGACGTTCATATTCGCCGTCTGCGTAAAGCGCTGGAACTGAACGGGCACGATCGTA
TGGTACAGACGGTTCGCGGAACAGGTTATCGTTTCTCTGCACGTTATTGA

Protein sequence :
MVKRILVVEDEAPIREMLCFVLEQNDYQPIEAADYDRAVNLLIEPWPDLILLDWMLPGGSGIQFIKHLKREAMTRDIPVV
MLTARGEEEDRVRGLEAGADDYITKPFSPKELVARIKAVMRRISPMAVEEVIEMQGLTLDPSSHRVMSGNQPLDMGPTEY
KLLHFFMTHTERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALELNGHDRMVQTVRGTGYRFSARY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-34 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-34 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_002649653.1 Response regulator in two-component regulatory system with PhoR HE999704.1.gene2815. Protein 1e-39 42
phoB YP_002649653.1 Response regulator in two-component regulatory system with PhoR BAC0596 Protein 2e-34 42
phoB YP_002649653.1 Response regulator in two-component regulatory system with PhoR CP001918.1.gene3444. Protein 3e-34 42
phoB YP_002649653.1 Response regulator in two-component regulatory system with PhoR CP001138.1.gene2239. Protein 2e-34 42
phoB YP_002649653.1 Response regulator in two-component regulatory system with PhoR AE016830.1.gene1681. Protein 5e-39 41
phoB YP_002649653.1 Response regulator in two-component regulatory system with PhoR NC_003923.1003749.p0 Protein 3e-34 41
phoB YP_002649653.1 Response regulator in two-component regulatory system with PhoR CP000647.1.gene2531. Protein 3e-34 41
phoB YP_002649653.1 Response regulator in two-component regulatory system with PhoR CP000034.1.gene2186. Protein 1e-33 41
phoB YP_002649653.1 Response regulator in two-component regulatory system with PhoR NC_002695.1.916589.p Protein 7e-34 41
phoB YP_002649653.1 Response regulator in two-component regulatory system with PhoR BAC0039 Protein 1e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_002649653.1 Response regulator in two-component regulatory system with PhoR VFG1563 Protein 8e-35 42
phoB YP_002649653.1 Response regulator in two-component regulatory system with PhoR VFG1702 Protein 8e-35 42