Gene Information

Name : EpC_18040 (EpC_18040)
Accession : YP_002648811.1
Strain : Erwinia pyrifoliae Ep1/96
Genome accession: NC_012214
Putative virulence/resistance : Resistance
Product : AraC family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 2036675 - 2037016 bp
Length : 342 bp
Strand : -
Note : silverDB:cEP01805

DNA sequence :
ATGAGTCATGATGATTTTATTAGCGATCTTGTGCAGTGGATCGATAACCATATTGAAGGAAAGATGGATTTAGATACGGT
TGCCGACCGGGCTGGCTATTCTAAATGGCACCTGCAGCGCATGTTCAAACAGCATACCGGTTACGCACTGGGTGAATACA
TTCGTCAACGCCGTCTGAAAAAATCTGCAGAGCGCCTCGCACGCGGCGGGGAGCCGATCCTCGATGTGGCAATCAGTTTT
GGCTTCGATTCGCAGCAATCCTTTAACCGCAGTTTTAAACGCCAGTTTGGTCAATCTCCGGGGGCCTGGCGGCGTCAGGT
ACGTACTGCCGTGCATGCCTGA

Protein sequence :
MSHDDFISDLVQWIDNHIEGKMDLDTVADRAGYSKWHLQRMFKQHTGYALGEYIRQRRLKKSAERLARGGEPILDVAISF
GFDSQQSFNRSFKRQFGQSPGAWRRQVRTAVHA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 3e-24 48
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 1e-20 46
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 1e-20 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EpC_18040 YP_002648811.1 AraC family transcriptional regulator NC_002695.1.914293.p Protein 7e-25 49
EpC_18040 YP_002648811.1 AraC family transcriptional regulator BAC0371 Protein 7e-25 49
EpC_18040 YP_002648811.1 AraC family transcriptional regulator CP001138.1.gene4488. Protein 8e-25 48
EpC_18040 YP_002648811.1 AraC family transcriptional regulator CP000647.1.gene4499. Protein 2e-25 48
EpC_18040 YP_002648811.1 AraC family transcriptional regulator CP000034.1.gene4505. Protein 1e-24 48
EpC_18040 YP_002648811.1 AraC family transcriptional regulator CP001918.1.gene327.p Protein 3e-25 48
EpC_18040 YP_002648811.1 AraC family transcriptional regulator CP000647.1.gene1624. Protein 6e-24 47
EpC_18040 YP_002648811.1 AraC family transcriptional regulator CP001918.1.gene2033. Protein 8e-24 47
EpC_18040 YP_002648811.1 AraC family transcriptional regulator NC_002695.1.917339.p Protein 1e-23 46
EpC_18040 YP_002648811.1 AraC family transcriptional regulator CP001138.1.gene1637. Protein 1e-23 46
EpC_18040 YP_002648811.1 AraC family transcriptional regulator BAC0560 Protein 1e-23 46
EpC_18040 YP_002648811.1 AraC family transcriptional regulator CP000034.1.gene1596. Protein 1e-23 46
EpC_18040 YP_002648811.1 AraC family transcriptional regulator NC_010558.1.6276025. Protein 4e-21 46
EpC_18040 YP_002648811.1 AraC family transcriptional regulator CP001138.1.gene612.p Protein 4e-22 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EpC_18040 YP_002648811.1 AraC family transcriptional regulator VFG0585 Protein 8e-25 48
EpC_18040 YP_002648811.1 AraC family transcriptional regulator VFG1038 Protein 4e-21 46