Gene Information

Name : EpC_09820 (EpC_09820)
Accession : YP_002648011.1
Strain : Erwinia pyrifoliae Ep1/96
Genome accession: NC_012214
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 1126606 - 1126908 bp
Length : 303 bp
Strand : -
Note : silverDB:cEP00983

DNA sequence :
ATGAAAAGAAGAAATTTTAGTCCTGAATTCAAACGTGAATCCGCTCAGTTGGTTGTTGATCAAAACTACACCGTCTCTGA
TGCCGCTAAGGCTATGGATGTCGGTCTTTCCACGATGACAAAATGGGTCAAGCAACTGCGTGATGAGCGGCAGGGCAAAA
CACCAAAAGCCTCTCCGATAACACCGGAACAAATCGAAATACGTGAGCTGAAGAAAAAGCTACAACGTATTGAAATGGAA
AACGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTCCCTGAACGGTTCTCGATAA

Protein sequence :
MKRRNFSPEFKRESAQLVVDQNYTVSDAAKAMDVGLSTMTKWVKQLRDERQGKTPKASPITPEQIEIRELKKKLQRIEME
NEILKKATALLMSDSLNGSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-34 94
l7045 CAD33744.1 - Not tested PAI I 536 Protein 5e-40 93
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 5e-40 93
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 5e-39 91
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-32 80
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 5e-32 80
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-32 80
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-32 80
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-32 80
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-32 80
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-32 80
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 5e-32 80
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 7e-29 69
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 7e-26 63
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 1e-25 63
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-24 61
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 3e-24 61
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 3e-24 61
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-24 61
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-22 57
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 3e-20 46
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 3e-13 44
tnpA CAB61575.1 transposase A Not tested HPI Protein 9e-20 44
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 5e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EpC_09820 YP_002648011.1 transposase VFG1485 Protein 2e-40 93
EpC_09820 YP_002648011.1 transposase VFG1123 Protein 2e-32 80
EpC_09820 YP_002648011.1 transposase VFG1553 Protein 3e-29 69
EpC_09820 YP_002648011.1 transposase VFG0784 Protein 8e-25 61
EpC_09820 YP_002648011.1 transposase VFG1566 Protein 1e-13 44
EpC_09820 YP_002648011.1 transposase VFG1521 Protein 2e-12 41