Gene Information

Name : srrA (Sca_1118)
Accession : YP_002634211.1
Strain : Staphylococcus carnosus TM300
Genome accession: NC_012121
Putative virulence/resistance : Virulence
Product : respiratory response regulator receiver SrrA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1138217 - 1138939 bp
Length : 723 bp
Strand : -
Note : (P35163) Transcriptional regulatory protein resD,InterPro: Response regulator receiver; Hypothetical protein

DNA sequence :
ATGACAAAAATACTTGTCGTTGATGATGAAGAAAGAATTCGAAGACTGCTTAAATTATATTTAGAAAGAGAATCTTTTGA
TATCGAAGAAGCTCAAGACGGCAAAGAAGCATTAGATATGGCATTAAACACTGATTATGCTTGTATCTTATTAGACTTAA
TGCTTCCCGAATTAGATGGTATTGAAGTTGCAAACCGTTTAAGAGAGTACAAAGATACACCGATTATTATGTTAACAGCA
AAAGGTGAAGAAACAAATCGTGTAGAAGGATTCGAATCAGGTGCAGATGATTATATTGTCAAACCTTTTTCTCCACGCGA
AGTAGTATTACGAGTTAAAGCTTTGCTTAGACGCACATTAACAGCAACTTCAGAACAAAATGAGCCTCACGCAAGAGACT
TAATTGAATTTAAGCACCTTGTCATTGATAATGATGCGCATCGTGTACTTGCTGATGGTACTCAAGTCAACTTAACACCT
AAAGAATATGAACTATTAATATTCTTAGCCAAAACACCTAACAAAGTTTTTGATCGCGAACAATTATTAAAAGATGTCTG
GCATTATGAATTCTATGGAGACTTGCGTACTGTAGATACTCATGTTAAACGTCTTAGAGAAAAGTTAAACCGTGTATCCT
CTGATGCAGCACATATGATTCAAACTGTATGGGGTGTCGGCTATAAATTTGAGGTCAACAATAATGATGAAACGACTCAA
TAG

Protein sequence :
MTKILVVDDEERIRRLLKLYLERESFDIEEAQDGKEALDMALNTDYACILLDLMLPELDGIEVANRLREYKDTPIIMLTA
KGEETNRVEGFESGADDYIVKPFSPREVVLRVKALLRRTLTATSEQNEPHARDLIEFKHLVIDNDAHRVLADGTQVNLTP
KEYELLIFLAKTPNKVFDREQLLKDVWHYEFYGDLRTVDTHVKRLREKLNRVSSDAAHMIQTVWGVGYKFEVNNNDETTQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-37 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
srrA YP_002634211.1 respiratory response regulator receiver SrrA HE999704.1.gene2815. Protein 2e-46 47
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_002952.2859905.p0 Protein 6e-40 46
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_009782.5559369.p0 Protein 7e-40 46
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_002951.3237708.p0 Protein 7e-40 46
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_003923.1003749.p0 Protein 6e-40 46
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_002758.1121668.p0 Protein 7e-40 46
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_007622.3794472.p0 Protein 5e-40 46
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_009641.5332272.p0 Protein 7e-40 46
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_013450.8614421.p0 Protein 7e-40 46
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_007793.3914279.p0 Protein 7e-40 46
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_002745.1124361.p0 Protein 7e-40 46
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_012469.1.7686381. Protein 1e-41 45
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_012469.1.7685629. Protein 2e-41 44
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_010079.5776364.p0 Protein 2e-40 42
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_002952.2859858.p0 Protein 2e-40 42
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_007622.3794948.p0 Protein 2e-40 42
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_003923.1003417.p0 Protein 2e-40 42
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_013450.8614146.p0 Protein 2e-40 42
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_002951.3238224.p0 Protein 2e-40 42
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_007793.3914065.p0 Protein 2e-40 42
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_002758.1121390.p0 Protein 2e-40 42
srrA YP_002634211.1 respiratory response regulator receiver SrrA AE016830.1.gene1681. Protein 2e-47 42
srrA YP_002634211.1 respiratory response regulator receiver SrrA AE000516.2.gene3505. Protein 4e-38 42
srrA YP_002634211.1 respiratory response regulator receiver SrrA AE015929.1.gene1106. Protein 3e-35 41
srrA YP_002634211.1 respiratory response regulator receiver SrrA BAC0039 Protein 4e-33 41
srrA YP_002634211.1 respiratory response regulator receiver SrrA CP001138.1.gene2239. Protein 2e-32 41
srrA YP_002634211.1 respiratory response regulator receiver SrrA CP000034.1.gene2186. Protein 4e-33 41
srrA YP_002634211.1 respiratory response regulator receiver SrrA NC_002695.1.916589.p Protein 3e-33 41
srrA YP_002634211.1 respiratory response regulator receiver SrrA BAC0596 Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
srrA YP_002634211.1 respiratory response regulator receiver SrrA VFG1563 Protein 2e-37 41
srrA YP_002634211.1 respiratory response regulator receiver SrrA VFG1702 Protein 4e-37 41