Gene Information

Name : Athe_0080 (Athe_0080)
Accession : YP_002572013.1
Strain : Caldicellulosiruptor bescii DSM 6725
Genome accession: NC_012034
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 101620 - 102312 bp
Length : 693 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: csc:Csac_2559 two component transcriptional regulator

DNA sequence :
ATGTCCAAAGCACATATTCTTGTTGTTGACGATGAAAAACCAATTGTTGATATTATAAAGTTCAATTTAGAAAAAGAAGG
ATATAAGGTAACAGCGTCATATGACGGTGAGGATGCGTTAAATAGAATAAAAAATGAAAACTTTGACATGGTACTTCTGG
ATGTGATGCTTCCTAAACTTGACGGGTTTTCTGTATGCAAAAAGGTCCGTGAGTTTTCAGATGTCCCAATTATAATGATA
ACAGCGAAGGCTGATGAGGTTGACAAGGTTTTGGGGCTGGAGCTTGGGGCAGATGATTACATAACAAAACCGTTTGGTAT
AAGAGAGCTCATTGCCAGAATTAGAGCAAATTTAAGAAGGACAGCTCAAAGCGCAGCTCAAGATGGAAAGGTATTAAAAG
CTGGGAATTTGACTTTGAACCCTGAGACGTTTGAAGTAAAGAAAGACGGCAAAGTTATTGAACTTACCGTAAGAGAATAT
GAGCTTTTGAAGTTTTTGATGTCGCAAAAGGGTCAGGTATTTTCAAGAGAAGAGCTTTTGGAAAAGGTTTGGGACTATGA
ATATTATGGAGATGTTAGAACAGTAGATGTTACTGTAAGAAGATTGAGAGAAAAAATAGAAGATAATCCATCAGAACCGA
ATTTTATTCTTACAAAGAGAGGAATTGGCTACTACTTTAATCCCAATATTTAA

Protein sequence :
MSKAHILVVDDEKPIVDIIKFNLEKEGYKVTASYDGEDALNRIKNENFDMVLLDVMLPKLDGFSVCKKVREFSDVPIIMI
TAKADEVDKVLGLELGADDYITKPFGIRELIARIRANLRRTAQSAAQDGKVLKAGNLTLNPETFEVKKDGKVIELTVREY
ELLKFLMSQKGQVFSREELLEKVWDYEYYGDVRTVDVTVRRLREKIEDNPSEPNFILTKRGIGYYFNPNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-54 56
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-49 51
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-49 51
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-49 50
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-49 50
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-49 50
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-49 50
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-49 50
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-49 50
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-49 50
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-49 50
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-43 48
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-44 47
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 3e-24 47
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-34 46
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 4e-28 46
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 9e-28 45
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 9e-28 45
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-41 44
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-35 44
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 5e-28 44
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 4e-31 44
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator BAC0533 Protein 5e-28 44
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-39 43
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 5e-37 43
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 9e-37 43
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-39 43
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-39 43
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-39 43
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-39 43
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-39 43
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-39 43
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-39 43
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-39 43
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 4e-34 42
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 9e-36 41
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-37 41
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator BAC0308 Protein 7e-28 41
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-31 41
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 1e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Athe_0080 YP_002572013.1 winged helix family two component transcriptional regulator VFG1563 Protein 3e-37 41