Gene Information

Name : Chy400_0951 (Chy400_0951)
Accession : YP_002568700.1
Strain : Chloroflexus sp. Y-400-fl
Genome accession: NC_012032
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1209487 - 1210188 bp
Length : 702 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cau:Caur_0876 response regulator receiver

DNA sequence :
ATGTCTCGCACCATCCTTGTGGTAGATGATGAACCGGGCATTGTCAAAATTGCCCGCGACTACCTTGAACGGGCCGGTTT
TCAGGTGATCAGTGCCGGCGATGGGCCGACAGCGTTACGGCTGGCGCGGCAGGAACATCCAGCCCTCATGGTACTCGATC
TGATGCTACCCGGTATGGATGGACTTGACGTAACCCGTGCCCTGCGCCAGGACCCGCTTACTGCGCGCTTACCGATCATC
ATGCTGACTGCCCGCGTCGAGGAGACCGACCGTCTGATTGGCCTGGAACTGGGTGCCGACGACTACATCACCAAACCCTT
CAGCCCCCGCGAACTGGTAGCGCGCGTGCGTGCCGTCTTGCGGCGCAGTGAAGGTTCAACCTCGCCAGGGAAGCAGATTC
AGATCGGCGGATTGGTTATCGACCTCGAATGCCGTAGTGTCCGCCGAGATGGTGAAACGATTGAACTGACCGCGACCGAA
TTCGATCTCCTTGCCGTTTTAGCCAGTGCGCCGGGTCGCCCCTTCACCCGTGCTCAATTGCTCGACCGTGTTTACAACAC
CGAATATACCGGCTTCGACCGGACTATCGACGCCCATATCAAAAATCTCCGCCGTAAGATTGAACCCGACTCGAATGGGC
CACCACGCCTGATCTTGACCGTCTACGGAGTTGGCTACAAGTTTGCCGAAACGTATCCATAA

Protein sequence :
MSRTILVVDDEPGIVKIARDYLERAGFQVISAGDGPTALRLARQEHPALMVLDLMLPGMDGLDVTRALRQDPLTARLPII
MLTARVEETDRLIGLELGADDYITKPFSPRELVARVRAVLRRSEGSTSPGKQIQIGGLVIDLECRSVRRDGETIELTATE
FDLLAVLASAPGRPFTRAQLLDRVYNTEYTGFDRTIDAHIKNLRRKIEPDSNGPPRLILTVYGVGYKFAETYP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-15 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-14 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-31 50
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-29 47
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-29 47
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-29 47
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-29 47
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-29 47
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-29 47
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 7e-29 47
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-29 47
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-29 47
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-29 47
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-29 47
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-29 47
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 8e-28 47
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 8e-29 46
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 2e-29 46
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator BAC0596 Protein 2e-29 46
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 1e-29 46
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 1e-27 45
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 1e-28 45
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 9e-29 45
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator BAC0039 Protein 1e-29 45
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 1e-29 45
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-25 44
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-17 43
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 3e-27 42
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 1e-23 42
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 1e-23 42
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 4e-26 42
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 2e-20 42
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 2e-29 41
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 6e-23 41
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 9e-24 41
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-23 41
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 5e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-22 44
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-21 42
Chy400_0951 YP_002568700.1 winged helix family two component transcriptional regulator VFG0596 Protein 9e-16 42