Gene Information

Name : Chy400_4163 (Chy400_4163)
Accession : YP_002571844.1
Strain : Chloroflexus sp. Y-400-fl
Genome accession: NC_012032
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5154690 - 5155382 bp
Length : 693 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cau:Caur_3854 response regulator receiver

DNA sequence :
ATGCGTCAGACGATCTTGATTATCGATGATCATCTCAATGTACGCACTATGATTGCCGACTACTTGCAAGAGATTGGATA
TCGCGTCGTTACAGCAAGCGACGGCGCGGAGGGCCTCATTATTGCCCGCCGCGTTCGTCCCGACCTGGTCTTGCTCGATA
TCATGATGCCCAAACTGGATGGCTTTGGTTTCTTACAGGCGTATCGCCGGGAACATCAGGCACCGGTCATCTTATTGACT
GCGCGAATTGATGAAACGGACAAGGTAGTCGGATTGGAACTGGGAGCCGACGATTATGTGACCAAACCCTTCAGCCTGAA
AGAATTGGTGGCACGAATCAGGGCAGTCTTGCGTCGAACAGCCGCAGCACGGCAACCGAATGAAGAACAGCCGTTGCGCA
TTGGCAACCTTGAACTGAATCGTGCAACCCGCATGGTAACGGTTGACGAACGGCCCATATACCTGACACCATCTGAGTTT
GCGTTACTGGCGTTGCTCATGGCTTCACCGGGACGTGTGTACACTCGCGAGCAACTCCTTGAACACCTCCAGGGCAACAG
TTATGAAGGGGTTGAACGAACGATTGACGTACACATTCGCAATCTACGCCGCAAAATCGAGCCGGATCCCACCAATCCAA
CCTACATCGAAACTGTCTTCGGCATCGGGTACCGCTGCCGTCCACTGAGTTAA

Protein sequence :
MRQTILIIDDHLNVRTMIADYLQEIGYRVVTASDGAEGLIIARRVRPDLVLLDIMMPKLDGFGFLQAYRREHQAPVILLT
ARIDETDKVVGLELGADDYVTKPFSLKELVARIRAVLRRTAAARQPNEEQPLRIGNLELNRATRMVTVDERPIYLTPSEF
ALLALLMASPGRVYTREQLLEHLQGNSYEGVERTIDVHIRNLRRKIEPDPTNPTYIETVFGIGYRCRPLS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-40 43
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-34 43
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 3e-29 43
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 1e-39 42
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-36 42
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-36 42
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-36 42
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-36 42
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-36 42
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-36 42
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-36 42
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-36 42
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-38 42
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-36 42
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-36 42
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-32 42
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 1e-32 41
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 6e-37 41
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 1e-32 41
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 1e-32 41
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-25 41
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 7e-35 41
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-38 41
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 2e-40 41
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator BAC0039 Protein 3e-40 41
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 3e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-35 43
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-31 42
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-29 42
Chy400_4163 YP_002571844.1 winged helix family two component transcriptional regulator VFG0473 Protein 2e-21 42