Gene Information

Name : Chy400_2703 (Chy400_2703)
Accession : YP_002570418.1
Strain : Chloroflexus sp. Y-400-fl
Genome accession: NC_012032
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3335099 - 3335776 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cau:Caur_2506 response regulator receiver

DNA sequence :
ATGACACGTATCTTGGTGATTGAAGACGAAACTGAAATAGCCTCGTTTCTACGCCGTGGTCTGAGCCTGGAAGGCTATCA
GGTTGATGTGGCCTTCGATGGGACACGCGGGCTTGAGCTGGCATCGACGGGCACGTATGATCTGATTGTCCTTGACCTCA
TGTTGCCGGGGATCGATGGTCTCGAAGTCGCTCGTCGTCTCCGTGCCGACTCGAACGTACCGATCATTATGCTCACGGCG
CGTGATGCCGTGCGTGATCGGGTGGCCGGTCTGGAAGCCGGCGCCGATGATTATCTGGTGAAGCCGTTTGCCTTTGAAGA
GCTGCTCGCCCGCATTCGGGCACAGTTGCGGCGTCGGCAGTCCGGGCAGGCGCAGGATGTGCTGCGTTTCGCCAATTTAA
CTCTCGATACGCGCTCGCGTGAGTTGCGGGTAGGAGACCGGCGTGTCGAGCTGACGGCGAAAGAGTACGATCTGCTCGAA
CTCTTTATGCGTCATCCCAATCAGGTGCTGACTCGCGATATTATTTACGACCGGGTCTGGAATTACGACTTCGGCGGCGA
GAGTAATATTCTGGAAGTGTACGTGCGCTATTTGCGGCAGAAGCTTGAGGCGAATGGTGAGCCGCGCCTGATCCATACTG
TTCGCAGTGTGGGGTACATTCTCCGCGAAGATACCTGA

Protein sequence :
MTRILVIEDETEIASFLRRGLSLEGYQVDVAFDGTRGLELASTGTYDLIVLDLMLPGIDGLEVARRLRADSNVPIIMLTA
RDAVRDRVAGLEAGADDYLVKPFAFEELLARIRAQLRRRQSGQAQDVLRFANLTLDTRSRELRVGDRRVELTAKEYDLLE
LFMRHPNQVLTRDIIYDRVWNYDFGGESNILEVYVRYLRQKLEANGEPRLIHTVRSVGYILREDT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-37 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-36 45
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-32 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-43 49
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-45 48
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator BAC0308 Protein 4e-42 48
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-43 48
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-41 48
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-36 48
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator BAC0111 Protein 4e-43 47
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator BAC0347 Protein 5e-39 44
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-43 43
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-37 43
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-43 43
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-43 43
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-43 43
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-43 43
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-43 43
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-43 43
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-43 43
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 4e-24 43
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 4e-33 41
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 9e-25 41
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 4e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-52 54
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-41 47
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-37 46
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator VFG1386 Protein 3e-42 45
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator VFG0473 Protein 2e-26 43
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator VFG1563 Protein 4e-32 41
Chy400_2703 YP_002570418.1 winged helix family two component transcriptional regulator VFG1702 Protein 5e-32 41