Gene Information

Name : Chy400_2623 (Chy400_2623)
Accession : YP_002570341.1
Strain : Chloroflexus sp. Y-400-fl
Genome accession: NC_012032
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3260006 - 3260701 bp
Length : 696 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cau:Caur_2434 response regulator receiver

DNA sequence :
ATGCACACACCCCTGATCCTCATTGTTGATGACGAGAATCGGTTGCGCGAACTCATTCAGCGCTACCTTATTCAGGCTGG
GTTTCGCGTCGCCCATGCCGGCGATGGTTTGAGTGCCCTTGCCCAGGCCAGGACACTCCGCCCCGATCTGATCATCCTCG
ATCTGATGTTGCCGGCACTCGACGGTTTTGAGGTCTGTCGCCAGTTACGAACATTTTCTGATGCATACATCTTAATGCTG
ACCGCAAAAGTAGAGGAACCTGATCGCGTCAAAGGGTTGGAGGTTGGGGCTGATGATTATCTGGTGAAACCCTTTTCACC
ACGTGAATTAGTGGCCCGCGTGCGCGCCATGTTTCGGCGTCCCCGCCAATCGGGGTATATCGATGAACCCTCGACAATGA
CGGTTGGGCCACTCACTATCGATAGTGAATCGCATACTGTGCGGTTAGATGGAGTACCCATCAATCTGACCCCGTTAGAA
TATCGGCTGTTAACCATACTGGCTGCCGCTCCCGGACGAGTCTTCTCACGCGCCCAATTGCTTGATCAAGTTTGGGGAAA
CAATTACTTCGGCGATGAACACGTTCTGGAAGTACATATTGCGAATTTACGCAAAAAATTGGGCGATGACCCGGCGCGCC
CCCGCTTTATCTTTACCGTCCGGAGTGTTGGTTATCGATTCGGAGAACGAACGTGA

Protein sequence :
MHTPLILIVDDENRLRELIQRYLIQAGFRVAHAGDGLSALAQARTLRPDLIILDLMLPALDGFEVCRQLRTFSDAYILML
TAKVEEPDRVKGLEVGADDYLVKPFSPRELVARVRAMFRRPRQSGYIDEPSTMTVGPLTIDSESHTVRLDGVPINLTPLE
YRLLTILAAAPGRVFSRAQLLDQVWGNNYFGDEHVLEVHIANLRKKLGDDPARPRFIFTVRSVGYRFGERT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-32 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-35 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-34 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 8e-43 49
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-42 46
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-40 45
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-40 45
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-40 45
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-40 45
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-40 45
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-40 45
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-40 45
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-40 45
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-40 45
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-40 45
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-40 44
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 4e-41 44
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 3e-41 44
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator BAC0039 Protein 4e-41 44
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator BAC0596 Protein 4e-41 44
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 4e-41 44
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-34 43
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-34 43
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-34 43
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-34 43
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-34 43
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-34 43
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-34 43
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-34 43
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 4e-36 43
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-36 43
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-36 43
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-40 43
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 1e-39 43
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 4e-40 43
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-31 42
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-38 42
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-31 42
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-30 42
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 2e-34 42
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 3e-37 41
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-41 41
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator BAC0197 Protein 7e-31 41
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 3e-36 41
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-30 41
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 3e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator VFG1389 Protein 6e-37 47
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-39 44
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator VFG0596 Protein 8e-33 42
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-35 41
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator VFG1702 Protein 7e-35 41
Chy400_2623 YP_002570341.1 winged helix family two component transcriptional regulator VFG1386 Protein 1e-33 41