Gene Information

Name : Chy400_0013 (Chy400_0013)
Accession : YP_002567785.1
Strain : Chloroflexus sp. Y-400-fl
Genome accession: NC_012032
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 15234 - 15635 bp
Length : 402 bp
Strand : -
Note : PFAM: regulatory protein MerR; Transcription regulator MerR DNA binding; KEGG: mar:MAE_03110 transcriptional regulator

DNA sequence : 
ATGATGCGTATTGGTGAACTTGCCCGCCAAACCGGTGTGTCGGTTAAAACCATTCGTTTTTACGAGCAGATTGGGGTGTT
GCCACCCCCGCCGCGGATGGAGAACAATTATCGGTTCTACTCACCAGACATGGTTGACCGCTTACGTTTCATTACCCATG
CGCGCAGTCTGGGTCTGTCATTACGCGAGATTGCTGCTATTCTCGCGCTAAGTGATCGCGGCGAACCCCCGTGCGGTGAG
ATGCTTGCCTCCCTGGATCGGCAAATTGCAGCTATCGATCAGCGCATTGCCGATCTTCAGGAACTTCGTACTGCGCTGAT
CGATCTTCGTCAGCGCGGCAATCAGGCCGCGACACCCTGGACCGATTGCATCTGTGCGCTGGTGCGTGATCGCCAGGTAT
GA

Protein sequence : 
MMRIGELARQTGVSVKTIRFYEQIGVLPPPPRMENNYRFYSPDMVDRLRFITHARSLGLSLREIAAILALSDRGEPPCGE
MLASLDRQIAAIDQRIADLQELRTALIDLRQRGNQAATPWTDCICALVRDRQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 3e-20 46
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 5e-20 46
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 5e-20 46
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 4e-20 46
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 4e-20 46
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 5e-20 46
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 4e-20 46
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 3e-20 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Chy400_0013 YP_002567785.1 MerR family transcriptional regulator BAC0058 Protein 2e-22 42
Chy400_0013 YP_002567785.1 MerR family transcriptional regulator BAC0682 Protein 9e-21 41