Gene Information

Name : MCCL_1138 (MCCL_1138)
Accession : YP_002560541.1
Strain : Macrococcus caseolyticus JCSC5402
Genome accession: NC_011999
Putative virulence/resistance : Virulence
Product : response regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1246462 - 1247169 bp
Length : 708 bp
Strand : -
Note : -

DNA sequence :
ATGAAAGAAAAGATTTTGATAGTTGATGATGAAGATAGAATTAGAAAGCTTGCTAAAATGTATCTAGAAAGAGAAGGCTA
TGAAACTGTAGAAGCAGAAGATGGAGAGCGTGCGCTTGAACTAGCGCTAAGTGAAAACTTTCATTGTATCTTACTAGATA
TCATGCTGCCAGGTATGGATGGTATTCAAGTATGCAAACGATTACGTGAAGAGAAATCTACACCTGTTATTATGCTGACT
GCAAAAGGAGAAGAGCATAATCGTGTAGAAGGCTTTGAAATTGGAGCAGACGATTATATCGTCAAACCGTTCTCTCCACG
AGAGGTTGTACTACGTGTAAAGGCAATTTTAAGGCGTTCGCAATCAACAATGTTCTTGCAACAGGAAGCGCATGCGAAAG
ATCTGATCGTTTTTGATTCCCTAGTGATAGATAACGATGCACATAGAGTGCTTGCAGATAATAAGGAGGTTAATTTAACT
CCAAAGGAATATGAACTATTACTTTTTCTGGCTAAGAGTCCAGATAAAGTATTTGATCGTGAGCAGCTGCTTAAGGATGT
ATGGCATTATGAGTTTTACGGCGATTTACGAACAGTTGATACACATGTGAAGCGATTAAGAGAAAAATTAAACAAAGTCT
CACCTCATGCTGCAAATATGATTCATACAGTATGGGGCGTAGGATATAAATTTGAGGTCAGAGACTGA

Protein sequence :
MKEKILIVDDEDRIRKLAKMYLEREGYETVEAEDGERALELALSENFHCILLDIMLPGMDGIQVCKRLREEKSTPVIMLT
AKGEEHNRVEGFEIGADDYIVKPFSPREVVLRVKAILRRSQSTMFLQQEAHAKDLIVFDSLVIDNDAHRVLADNKEVNLT
PKEYELLLFLAKSPDKVFDREQLLKDVWHYEFYGDLRTVDTHVKRLREKLNKVSPHAANMIHTVWGVGYKFEVRD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-40 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-40 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MCCL_1138 YP_002560541.1 response regulator protein NC_009641.5332272.p0 Protein 5e-48 52
MCCL_1138 YP_002560541.1 response regulator protein NC_013450.8614421.p0 Protein 5e-48 52
MCCL_1138 YP_002560541.1 response regulator protein NC_007793.3914279.p0 Protein 5e-48 52
MCCL_1138 YP_002560541.1 response regulator protein NC_002745.1124361.p0 Protein 5e-48 52
MCCL_1138 YP_002560541.1 response regulator protein NC_009782.5559369.p0 Protein 5e-48 52
MCCL_1138 YP_002560541.1 response regulator protein NC_002951.3237708.p0 Protein 5e-48 52
MCCL_1138 YP_002560541.1 response regulator protein NC_003923.1003749.p0 Protein 4e-48 52
MCCL_1138 YP_002560541.1 response regulator protein NC_002758.1121668.p0 Protein 5e-48 52
MCCL_1138 YP_002560541.1 response regulator protein NC_002952.2859905.p0 Protein 7e-48 51
MCCL_1138 YP_002560541.1 response regulator protein NC_007622.3794472.p0 Protein 7e-48 51
MCCL_1138 YP_002560541.1 response regulator protein HE999704.1.gene2815. Protein 3e-49 49
MCCL_1138 YP_002560541.1 response regulator protein NC_012469.1.7685629. Protein 3e-41 48
MCCL_1138 YP_002560541.1 response regulator protein NC_012469.1.7686381. Protein 2e-47 46
MCCL_1138 YP_002560541.1 response regulator protein AE016830.1.gene1681. Protein 5e-49 45
MCCL_1138 YP_002560541.1 response regulator protein CP000647.1.gene2531. Protein 1e-35 43
MCCL_1138 YP_002560541.1 response regulator protein AF130997.1.orf0.gene Protein 3e-36 42
MCCL_1138 YP_002560541.1 response regulator protein AM180355.1.gene1830. Protein 9e-38 42
MCCL_1138 YP_002560541.1 response regulator protein DQ212986.1.gene4.p01 Protein 6e-39 42
MCCL_1138 YP_002560541.1 response regulator protein CP001138.1.gene2239. Protein 7e-35 42
MCCL_1138 YP_002560541.1 response regulator protein CP000034.1.gene2186. Protein 6e-35 42
MCCL_1138 YP_002560541.1 response regulator protein NC_002695.1.916589.p Protein 5e-35 42
MCCL_1138 YP_002560541.1 response regulator protein BAC0596 Protein 7e-35 42
MCCL_1138 YP_002560541.1 response regulator protein BAC0039 Protein 6e-35 42
MCCL_1138 YP_002560541.1 response regulator protein HE999704.1.gene1528. Protein 1e-36 41
MCCL_1138 YP_002560541.1 response regulator protein CP004022.1.gene1676. Protein 1e-33 41
MCCL_1138 YP_002560541.1 response regulator protein CP001918.1.gene3444. Protein 2e-33 41
MCCL_1138 YP_002560541.1 response regulator protein CP004022.1.gene3215. Protein 1e-29 41
MCCL_1138 YP_002560541.1 response regulator protein CP000034.1.gene3834. Protein 3e-26 41
MCCL_1138 YP_002560541.1 response regulator protein CP001138.1.gene4273. Protein 4e-25 41
MCCL_1138 YP_002560541.1 response regulator protein NC_002695.1.915041.p Protein 3e-26 41
MCCL_1138 YP_002560541.1 response regulator protein CP001918.1.gene5135. Protein 2e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MCCL_1138 YP_002560541.1 response regulator protein VFG1563 Protein 6e-41 42
MCCL_1138 YP_002560541.1 response regulator protein VFG1702 Protein 2e-40 41