Gene Information

Name : marA (LF82_1275)
Accession : YP_002556404.1
Strain : Escherichia coli LF82
Genome accession: NC_011993
Putative virulence/resistance : Resistance
Product : Multiple antibiotic resistance protein marA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1565937 - 1566326 bp
Length : 390 bp
Strand : +
Note : 536; 55989; APEC_01; ATC8739; CFT073; E24377A; ED1a; HS; IAI1; IAI39; E2348, EDL933; EC4115; 157_H7; S88; SE11; SMS_3_5; UMN026; UTI89; K12_DH10B; K12_MG1655; K12_W3110

DNA sequence :
ATGACGATGTCCAGACGCAATACTGACGCTATTACCATTCATAGCATTTTGGACTGGATCGAGGACAACCTGGAATCGCC
ACTGTCACTGGAGAAAGTGTCAGAGCGTTCGGGTTACTCCAAATGGCACCTGCAACGGATGTTTAAAAAAGAAACCGGTC
ATTCATTAGGTCAATACATCCGTAGCCGTAAGATGACGGAAATCGCGCAAAAGCTGAAGGAAAGTAACGAGCCGATACTC
TATCTGGCAGAACGATATGGCTTCGAGTCCCAACAAACTCTGACCCGAACCTTCAAAAATTACTTTGATGTTCCGCCGCA
TAAATACCGGATGACCAATATGCAGGGTGAATCGCGCTTTTTACATCCATTAAATCATTACAACAACTAG

Protein sequence :
MTMSRRNTDAITIHSILDWIEDNLESPLSLEKVSERSGYSKWHLQRMFKKETGHSLGQYIRSRKMTEIAQKLKESNEPIL
YLAERYGFESQQTLTRTFKNYFDVPPHKYRMTNMQGESRFLHPLNHYNN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 3e-21 43
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 3e-21 43
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 1e-19 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_002556404.1 Multiple antibiotic resistance protein marA NC_002695.1.917339.p Protein 9e-57 99
marA YP_002556404.1 Multiple antibiotic resistance protein marA CP000034.1.gene1596. Protein 1e-57 99
marA YP_002556404.1 Multiple antibiotic resistance protein marA BAC0560 Protein 9e-57 99
marA YP_002556404.1 Multiple antibiotic resistance protein marA CP001138.1.gene1637. Protein 2e-53 96
marA YP_002556404.1 Multiple antibiotic resistance protein marA CP001918.1.gene2033. Protein 1e-52 93
marA YP_002556404.1 Multiple antibiotic resistance protein marA CP000647.1.gene1624. Protein 1e-52 93
marA YP_002556404.1 Multiple antibiotic resistance protein marA CP001138.1.gene612.p Protein 6e-23 43
marA YP_002556404.1 Multiple antibiotic resistance protein marA NC_010558.1.6276025. Protein 2e-21 43
marA YP_002556404.1 Multiple antibiotic resistance protein marA CP000034.1.gene4505. Protein 2e-19 42
marA YP_002556404.1 Multiple antibiotic resistance protein marA BAC0371 Protein 1e-19 42
marA YP_002556404.1 Multiple antibiotic resistance protein marA CP001138.1.gene4488. Protein 4e-20 42
marA YP_002556404.1 Multiple antibiotic resistance protein marA NC_002695.1.914293.p Protein 1e-19 42
marA YP_002556404.1 Multiple antibiotic resistance protein marA CP001918.1.gene327.p Protein 3e-20 42
marA YP_002556404.1 Multiple antibiotic resistance protein marA CP000647.1.gene4499. Protein 7e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
marA YP_002556404.1 Multiple antibiotic resistance protein marA VFG1038 Protein 1e-21 43
marA YP_002556404.1 Multiple antibiotic resistance protein marA VFG0585 Protein 4e-20 42