Gene Information

Name : Dtpsy_2215 (Dtpsy_2215)
Accession : YP_002553654.1
Strain : Acidovorax ebreus TPSY
Genome accession: NC_011992
Putative virulence/resistance : Virulence
Product : winged helix family two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2357944 - 2358630 bp
Length : 687 bp
Strand : +
Note : KEGG: dac:Daci_1091 two component heavy metal response transcriptional regulator; TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGAAGTTGTTGATTGTTGAAGACGAGATCAAGCTGGCCGAATACCTGCGCAAGGGCCTGTCCGAGGAGGGCTATGTGGT
GGAGGTGGCGCACAACGGTGTGGATGGTTTGCACTTGGCGATGGAAGGCGCATACGACCTGATCGTCCTGGATGGCATGT
TGCCGGGCATAGACGGAATGGGGGTGCTGGCCGCACTGCGGCAATCCAGGCAAACACCCGTTTTAATGCTGACGGCGCGC
ATGCGTGTCGAAGACCGGGTGCGCGGCCTGAAGGCCGGGGCGGATGACTATTTGGTCAAACCCTTTGCATTTACCGAGCT
GGTGGCGCGGATCGAGGTTCTGCTTAAACGCTCCCATCCGCTCCCTGCAAGTCACGAAGCACTTACGCTGGCAATAGACG
ATCTGCACATGGACCTGGTGCGGCGGCGTGTGGAACGGGCGGGCAAGCGTCTTAACCTGACAGCCAAGGAGTTTCAACTA
CTGTCTCTGCTATTGCGTAGGCAAGGTGAAGTGCTTTCACGTGCTGAAATCGCGGAGCAGGTTTGGGACGTCAATTTTGA
CCATGGCACCAACGTGATCGACGTCGCAATACGACGCCTGCGCGCCAAAATGGACACGCCGTTCGATCGGCCGTTGCTTC
ATACGGTGCGTGGCATGGGCTACGTGCTGGAGGCGCGAGCAAAATGA

Protein sequence :
MKLLIVEDEIKLAEYLRKGLSEEGYVVEVAHNGVDGLHLAMEGAYDLIVLDGMLPGIDGMGVLAALRQSRQTPVLMLTAR
MRVEDRVRGLKAGADDYLVKPFAFTELVARIEVLLKRSHPLPASHEALTLAIDDLHMDLVRRRVERAGKRLNLTAKEFQL
LSLLLRRQGEVLSRAEIAEQVWDVNFDHGTNVIDVAIRRLRAKMDTPFDRPLLHTVRGMGYVLEARAK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-57 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-57 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator BAC0125 Protein 4e-62 60
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator BAC0083 Protein 3e-59 58
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator BAC0197 Protein 7e-62 58
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator BAC0638 Protein 4e-52 57
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator BAC0308 Protein 3e-56 56
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator BAC0111 Protein 4e-60 56
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator BAC0347 Protein 9e-54 53
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 8e-33 43
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 4e-36 42
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 4e-36 42
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 4e-36 42
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 4e-36 42
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 4e-36 42
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 4e-36 42
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 4e-36 42
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 4e-36 42
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator CP001918.1.gene5135. Protein 3e-23 42
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator CP000034.1.gene3834. Protein 3e-26 42
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator CP001138.1.gene4273. Protein 1e-26 42
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator NC_002695.1.915041.p Protein 3e-26 42
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 5e-32 41
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator BAC0487 Protein 5e-28 41
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator CP000647.1.gene4257. Protein 4e-26 41
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator BAC0533 Protein 4e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator VFG0596 Protein 4e-58 56
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator VFG1389 Protein 2e-36 45
Dtpsy_2215 YP_002553654.1 winged helix family two component heavy metal response transcriptional regulator VFG1390 Protein 3e-41 44