Gene Information

Name : Dtpsy_2131 (Dtpsy_2131)
Accession : YP_002553584.1
Strain : Acidovorax ebreus TPSY
Genome accession: NC_011992
Putative virulence/resistance : Resistance
Product : mercuric transport protein periplasmic component
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 2279441 - 2279716 bp
Length : 276 bp
Strand : +
Note : TIGRFAM: mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein; KEGG: sew:SeSA_B0081 mercuric transport protein periplasmic component

DNA sequence :
ATGAAGAAACTGTTTGCCTCCCTTGCCCTCGCCGCCGCTGTTGCCCCGGTGTGGGCCGCTACCCAGACCGTCACGCTAGC
GGTTCCCGGCATGACTTGCGCCGCCTGCCCGATCACAGTCAAGAAAGCGCTCTCCAAGGTCGAAGGCGTGAGCAAGGTCG
ATGTGGGCTTCGAGAAGCGCGAGGCCGTCGTCACTTTTGACGACACCAAGGCCAGCGTACAGAAGCTGACCAAGGCCACC
GCAGACGCCGGCTATCCGTCCAGCGTCAAGCAGTGA

Protein sequence :
MKKLFASLALAAAVAPVWAATQTVTLAVPGMTCAACPITVKKALSKVEGVSKVDVGFEKREAVVTFDDTKASVQKLTKAT
ADAGYPSSVKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ABQ57373.1 MerP Not tested SGI1 Protein 7e-25 100
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 7e-25 100
merP AFG30122.1 MerP Not tested PAGI-2 Protein 7e-25 100
merP AGK07023.1 MerP Not tested SGI1 Protein 7e-25 100
merP AGK07081.1 MerP Not tested SGI1 Protein 7e-25 100
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-24 100
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 7e-22 81
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 5e-22 81
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 1e-21 81

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtpsy_2131 YP_002553584.1 mercuric transport protein periplasmic component BAC0679 Protein 1e-22 88
Dtpsy_2131 YP_002553584.1 mercuric transport protein periplasmic component BAC0678 Protein 7e-23 88
Dtpsy_2131 YP_002553584.1 mercuric transport protein periplasmic component BAC0231 Protein 3e-22 85
Dtpsy_2131 YP_002553584.1 mercuric transport protein periplasmic component BAC0675 Protein 4e-19 70
Dtpsy_2131 YP_002553584.1 mercuric transport protein periplasmic component BAC0674 Protein 8e-16 60