Gene Information

Name : Avi_9622 (Avi_9622)
Accession : YP_002551464.1
Strain :
Genome accession: NC_011991
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 85269 - 85622 bp
Length : 354 bp
Strand : +
Note : -

DNA sequence :
ATGATCGTCGCGGGCCAACGACTGCCGATCCTGATCGCAACGCGTCCGGTTGACTTCCGCTGTGGTCATCAGGCCTTGGC
TCTAATGGTGCAGACCGAATTGAAGCTCGATCCGCATTCTGGGGTGACGGTGATCTTTCGCTCAAAACGCGGGGACCGCC
TAAAAATCCTGGTGTGGGATGGCACCGGAATGGTGCTCATCTACAAAATTCTTGAACATGGAAACTTTGCTTGGCCCAAG
GTTCAGGATGGGACGATGCGTCTTTCCAGGGGTCAATACGAGGCTTTGTTCGAGGGTCTTGACTGGCGGCGGGTCATGGC
GCAACGGGTGACGGCGCCGTCGGCGGCAGGGTGA

Protein sequence :
MIVAGQRLPILIATRPVDFRCGHQALALMVQTELKLDPHSGVTVIFRSKRGDRLKILVWDGTGMVLIYKILEHGNFAWPK
VQDGTMRLSRGQYEALFEGLDWRRVMAQRVTAPSAAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAL99258.1 unknown Not tested LEE Protein 6e-13 48
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 9e-13 48
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 6e-13 48
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-12 48
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-12 48
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-12 48
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-12 48
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 9e-13 48
unnamed AAC31493.1 L0014 Not tested LEE Protein 6e-13 48
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 9e-13 48
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 6e-13 48
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 9e-13 48
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-12 47
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 4e-17 46
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-12 45
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-12 45
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-12 45
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-12 44
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-12 44
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-12 43
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-12 43
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-12 42
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 4e-12 41
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 4e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Avi_9622 YP_002551464.1 transposase VFG1709 Protein 3e-13 48
Avi_9622 YP_002551464.1 transposase VFG0792 Protein 3e-13 48
Avi_9622 YP_002551464.1 transposase VFG1698 Protein 4e-13 48
Avi_9622 YP_002551464.1 transposase VFG1052 Protein 6e-13 47
Avi_9622 YP_002551464.1 transposase VFG1665 Protein 5e-13 45
Avi_9622 YP_002551464.1 transposase VFG1737 Protein 8e-13 42