Gene Information

Name : phoP (Avi_1358)
Accession : YP_002548975.1
Strain :
Genome accession: NC_011989
Putative virulence/resistance : Virulence
Product : two component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1135659 - 1136333 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGCGCATTCTCGTCGTCGAGGACGATGTCAACCTGAACCGCCAGCTGGTCGAGGCGCTTCAGGAGGCAGGCTATGTGGT
CGACCAGGCTATGGATGGCGAGGAAGGTCATTATCTCGGTGATACCGAGCCCTATGACGCCGTGATCCTCGATATCGGTC
TGCCGACCATGGACGGCATTACGGTTCTGGAAAAATGGCGCTCTGCCGGACGTGCCATGCCGGTGCTGATCCTGACCGCC
CGCGACCGCTGGAGCGACAAGGTATCCGGTATCGACGCTGGTGCCGACGACTATGTCACTAAGCCTTTCCACGTCGAAGA
GGTGCTGGCGCGCATCCGGGCGCTGATTCGCCGCGCCGCCGGCCATGCCTCGTCGGAAATCGCCTGCGGGCCGGTGCGGC
TCGACACCAAGAGTTCCAAGGTCACCGTTTCGGGCAAGGCGCTGAAACTCACTTCCCATGAATTCCGGCTGCTGTCTTAT
CTCATGCATCACATGGGGGAGGTCGTGTCGCGCACCGAACTGGTCGAGCATATGTATGACCAGGATTTCGACCGCGATTC
CAACACGATCGAAGTGTTTGTCGGGCGGCTGCGCAAGAAGATCGGGCTGGACATGATCGAGACCGTGCGCGGTCTAGGCT
ACCGGATCAAAGCGCCTGACAGCGTCGAGGGCTAG

Protein sequence :
MRILVVEDDVNLNRQLVEALQEAGYVVDQAMDGEEGHYLGDTEPYDAVILDIGLPTMDGITVLEKWRSAGRAMPVLILTA
RDRWSDKVSGIDAGADDYVTKPFHVEEVLARIRALIRRAAGHASSEIACGPVRLDTKSSKVTVSGKALKLTSHEFRLLSY
LMHHMGEVVSRTELVEHMYDQDFDRDSNTIEVFVGRLRKKIGLDMIETVRGLGYRIKAPDSVEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_002548975.1 two component response regulator CP000647.1.gene1136. Protein 2e-37 48
phoP YP_002548975.1 two component response regulator BAC0530 Protein 2e-37 48
phoP YP_002548975.1 two component response regulator CP001918.1.gene2526. Protein 1e-36 47
phoP YP_002548975.1 two component response regulator NC_002516.2.879194.p Protein 8e-40 47
phoP YP_002548975.1 two component response regulator CP001138.1.gene1939. Protein 2e-37 46
phoP YP_002548975.1 two component response regulator CP000034.1.gene2022. Protein 2e-37 45
phoP YP_002548975.1 two component response regulator NC_002695.1.913289.p Protein 8e-37 45
phoP YP_002548975.1 two component response regulator BAC0487 Protein 8e-29 45
phoP YP_002548975.1 two component response regulator BAC0111 Protein 2e-31 44
phoP YP_002548975.1 two component response regulator CP004022.1.gene1005. Protein 1e-39 44
phoP YP_002548975.1 two component response regulator BAC0347 Protein 5e-29 43
phoP YP_002548975.1 two component response regulator BAC0197 Protein 2e-29 43
phoP YP_002548975.1 two component response regulator BAC0308 Protein 1e-26 42
phoP YP_002548975.1 two component response regulator BAC0125 Protein 3e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_002548975.1 two component response regulator VFG0475 Protein 2e-37 46
phoP YP_002548975.1 two component response regulator VFG0596 Protein 1e-27 42
phoP YP_002548975.1 two component response regulator VFG0473 Protein 1e-28 41