Gene Information

Name : feuP (Arad_1490)
Accession : YP_002543841.1
Strain :
Genome accession: NC_011985
Putative virulence/resistance : Virulence
Product : two-component response regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1183027 - 1183698 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGCGAATTCTCATTGTCGAAGACGATATCAATCTCAATCGCCAGCTTGCCGATGCCTTGAAAGAGGCAGGCTATGTGGT
CGATACAGCCTTCGACGGCGAGGAAGGGCATTTCCTCGGCGATACCGAACCTTATGACGCCATCATCCTCGATATCGGCC
TTCCGGAAATGGATGGGATCACCGTGCTCGAGAAATGGCGTGGTGCGGGCCGGGGAACGCCGGTGCTGATCCTGACGGCC
CGCGACCGCTGGAGCGACAAGGTCGCCGGCATTGACGCCGGCGCCGACGACTATGTCGCCAAGCCCTTCCACGTCGAGGA
AGTATTGGCGCGCATCCGGGCGCTGATCCGCCGTGCCGCCGGCCACTCCTCATCCGAAATCATCTGCGGCCCGGTGCGCC
TCGACACCAAGAGTTCGAAGGCGAGCGTCGACGGCAAGCCGTTGAAGCTCACCTCGCATGAATACCGCCTGCTCGCCTAT
CTCATGCATCATAAGGGCGAAGTCGTCTCGCGCACCGAGCTGGTCGAGCATATGTACGATCAGGATTTCGACCGCGATTC
CAACACGATCGAGGTTTTCGTTGGCCGTCTGCGCAAGAAGATGGGCGTCGACCTGATCGAGACCGTCCGTGGTCTGGGCT
ACCGCATCCAAGCTCCGACCAATGCGAATTAA

Protein sequence :
MRILIVEDDINLNRQLADALKEAGYVVDTAFDGEEGHFLGDTEPYDAIILDIGLPEMDGITVLEKWRGAGRGTPVLILTA
RDRWSDKVAGIDAGADDYVAKPFHVEEVLARIRALIRRAAGHSSSEIICGPVRLDTKSSKASVDGKPLKLTSHEYRLLAY
LMHHKGEVVSRTELVEHMYDQDFDRDSNTIEVFVGRLRKKMGVDLIETVRGLGYRIQAPTNAN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-27 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-27 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
feuP YP_002543841.1 two-component response regulator protein NC_002516.2.879194.p Protein 1e-39 47
feuP YP_002543841.1 two-component response regulator protein CP000647.1.gene1136. Protein 6e-37 46
feuP YP_002543841.1 two-component response regulator protein BAC0530 Protein 5e-37 46
feuP YP_002543841.1 two-component response regulator protein BAC0487 Protein 1e-28 45
feuP YP_002543841.1 two-component response regulator protein CP004022.1.gene1005. Protein 3e-40 44
feuP YP_002543841.1 two-component response regulator protein CP001918.1.gene2526. Protein 6e-35 44
feuP YP_002543841.1 two-component response regulator protein CP001138.1.gene1939. Protein 3e-36 44
feuP YP_002543841.1 two-component response regulator protein BAC0347 Protein 6e-28 43
feuP YP_002543841.1 two-component response regulator protein NC_002695.1.913289.p Protein 5e-35 43
feuP YP_002543841.1 two-component response regulator protein CP000034.1.gene2022. Protein 1e-35 43
feuP YP_002543841.1 two-component response regulator protein BAC0111 Protein 2e-30 42
feuP YP_002543841.1 two-component response regulator protein BAC0197 Protein 2e-29 41
feuP YP_002543841.1 two-component response regulator protein BAC0308 Protein 7e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
feuP YP_002543841.1 two-component response regulator protein VFG0596 Protein 5e-28 44
feuP YP_002543841.1 two-component response regulator protein VFG0475 Protein 3e-36 44
feuP YP_002543841.1 two-component response regulator protein VFG0473 Protein 9e-28 42
feuP YP_002543841.1 two-component response regulator protein VFG1390 Protein 2e-26 41
feuP YP_002543841.1 two-component response regulator protein VFG1389 Protein 1e-27 41