Gene Information

Name : terD (BCQ_0488)
Accession : YP_002528252.1
Strain : Bacillus cereus Q1
Genome accession: NC_011969
Putative virulence/resistance : Resistance
Product : tellurium resistance protein, terd family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 485663 - 486247 bp
Length : 585 bp
Strand : +
Note : Code: T; COG: COG2310

DNA sequence :
ATGGCATCAATTTCATTGAAAAAAGGACAAAAGGTAGACTTAACAAAAACGAATCCAGGTCTTTCAAAAGTTCTTGTAGG
ACTTGGTTGGGATACAAATCGTTATGATGGACAAGCTGATTTTGATTTAGATGTTAGTATTTTCTTAGTAGGTGCGAACG
GTAAAGTTTCAGGTGCAGAGGATTTCGTTTTCTATAATAATCCAAAAGGCGCAAATGGTGCTGTAGAGCATCTAGGAGAT
AACCGAACTGGCGAAGGTGAAGGCGATGATGAATCTATCAAAGTAGATTTGAAAAATGTACCTGCACATATCGAACGTAT
TTGTTTCACAATTACAATTTACGATGGAGAAGGTCGTAGCCAAAACTTTGGTCAAGTTTCTAACTCTTTCGTACGTATTT
TAGATGAAGAAAAGAATGCAGAGTTAATTCGTTACGATTTAGGAGAAGATTTCTCTATTGAAACAGCTGTTGTAGTAGGT
GAACTATACCGCCATGCAGGTGACTGGAAGTTCAATGCAATCGGAAGTGGATTCCAAGGTGGATTAGCGTCTCTATGTAA
TAACTTTGGTTTAGACGTAGAGTAA

Protein sequence :
MASISLKKGQKVDLTKTNPGLSKVLVGLGWDTNRYDGQADFDLDVSIFLVGANGKVSGAEDFVFYNNPKGANGAVEHLGD
NRTGEGEGDDESIKVDLKNVPAHIERICFTITIYDGEGRSQNFGQVSNSFVRILDEEKNAELIRYDLGEDFSIETAVVVG
ELYRHAGDWKFNAIGSGFQGGLASLCNNFGLDVE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-55 57
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-55 55
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-55 55
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-51 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-51 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-51 54
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-54 54
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-49 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD YP_002528252.1 tellurium resistance protein, terd family BAC0389 Protein 2e-55 57
terD YP_002528252.1 tellurium resistance protein, terd family BAC0390 Protein 3e-53 55