Gene Information

Name : RSKD131_0340 (RSKD131_0340)
Accession : YP_002524701.1
Strain :
Genome accession: NC_011963
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 335299 - 335577 bp
Length : 279 bp
Strand : -
Note : -

DNA sequence :
GTGCGCGTGTTCCTCGCCGCGGGCACCACGGACATGCGCTGCGGGATCGCCGGGCTTTGCGCGCGGGCGAAGAAGGTGCT
GGGAGAGGATCCCGCCGGCGGCGCGCTCCTGGTGTTTCGGGGACGCATGGGCGACCGGCTGAAGATCTTGCATTGGGATG
GGCAGGGCTTCTGCCTCTATTACAAGGTGCTCGAGCGCGGGCACTTCCCCTGGCCGAAGGCCACCGAGGGCAAGGTTGCG
CTGACACCGGCGCAAATGGCGATGCTCTGGGAAGGATGA

Protein sequence :
MRVFLAAGTTDMRCGIAGLCARAKKVLGEDPAGGALLVFRGRMGDRLKILHWDGQGFCLYYKVLERGHFPWPKATEGKVA
LTPAQMAMLWEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-19 55
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-19 55
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 5e-18 54
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 3e-19 54
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 5e-18 54
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-17 53
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-17 53
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 4e-18 53
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 5e-17 52
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 5e-17 52
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-17 52
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 5e-17 52
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-17 52
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-17 52
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 6e-17 52
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-17 52
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 6e-17 52
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-17 52
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-17 51
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 7e-17 51
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 7e-17 51
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 4e-14 50
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-15 49
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-15 49
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-16 49

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RSKD131_0340 YP_002524701.1 IS66 Orf2 family protein VFG1665 Protein 1e-19 54
RSKD131_0340 YP_002524701.1 IS66 Orf2 family protein VFG1698 Protein 4e-18 53
RSKD131_0340 YP_002524701.1 IS66 Orf2 family protein VFG0792 Protein 1e-17 52
RSKD131_0340 YP_002524701.1 IS66 Orf2 family protein VFG1709 Protein 1e-17 52
RSKD131_0340 YP_002524701.1 IS66 Orf2 family protein VFG1052 Protein 2e-17 51
RSKD131_0340 YP_002524701.1 IS66 Orf2 family protein VFG1517 Protein 2e-14 50
RSKD131_0340 YP_002524701.1 IS66 Orf2 family protein VFG1737 Protein 3e-17 49