|
Name : ureA (trd_0533) Accession : YP_002521779.1 Strain : Thermomicrobium roseum DSM 5159 Genome accession: NC_011959 Putative virulence/resistance : Virulence Product : urease subunit gamma Function : - COG functional category : E : Amino acid transport and metabolism COG ID : COG0831 EC number : - Position : 531095 - 531391 bp Length : 297 bp Strand : - Note : an automated process has identified a potential problem with this gene model; the current end5 and/or the end3 may need to extended or the current gene model may need to be merged with a neighboring gene model; the current gene model (or a revised gene mo DNA sequence : GTGACCCCGAAGGAGCTCGACCGGTTGACCGTGTTCACTTTGGCTGAACTCGCCCGTCGCCACCGCGCACGCGGGATCAA GCTCAATTATACGGAGGCTGCTGCCCTTCTCTGCGACGAAGTGTACGAAGAAGCACGCGCTGGTCGCTCCTACGAGGAGG TGGTCGCGCATGCCAGTTCCCTCCTCACGCGCGATGACGTTCTCCCTGGTGTTCCGGAAATGCTCACCGTTCTCCACATC GACGCGCTCTTCCCTGACGGTACGCGCCTCGTGACCCTCAGGAATCCCATCCGATGA Protein sequence : MTPKELDRLTVFTLAELARRHRARGIKLNYTEAAALLCDEVYEEARAGRSYEEVVAHASSLLTRDDVLPGVPEMLTVLHI DALFPDGTRLVTLRNPIR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ureA | NP_286678.1 | urease subunit gamma | Virulence | TAI | Protein | 2e-14 | 46 |
| ureA | NP_287086.1 | urease subunit gamma | Not tested | TAI | Protein | 2e-14 | 46 |
| ureA | YP_005684268.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 2e-20 | 45 |
| ureA | YP_003784327.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 2e-20 | 45 |
| ureA | YP_005686360.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 2e-20 | 45 |
| ureA | YP_005682176.1 | urease subunit gamma | Not tested | PiCp 7 | Protein | 2e-20 | 45 |
