Gene Information

Name : RSKD131_3419 (RSKD131_3419)
Accession : YP_002520352.1
Strain :
Genome accession: NC_011958
Putative virulence/resistance : Virulence
Product : Two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 329558 - 330244 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :

ATGGAGAATGACATGAAGATCCTGCTTGCCGAGGACGACCGCCAGACCGCCGACTACCTCCGCCAGGGTCTTCTGGCCGA
GGGCTACAGCGTGGATCATGTGCCCGACGGGCGCGATGCGCTGGTGCAGGCGACGCTGCAGCCCTACGACCTCCTCGTGG
TCGACCGGATGATGCCGGGGCTCGACGGGCTCTCGCTCGTCAAGGCACTGCGCTCGGCGCAGATCAAGGCGCCGATCCTG
ATCCTCACCGCCATGGGCGGGGTGACGGACCGGGTCGAGGGGTTGCAGGCCGGGGCCGACGATTATCTGGTCAAGCCCTT
CGCCTTCTCGGAACTGTCGGCGCGGCTGGCGGCGCTGGCCCGTCGTCCTGCCCTGGCCGAGGGGGCGCGCGATCTGTTGC
GGGTGGGCGATCTCACGCTCGACACCGTGCGCCGCACCGTCAGCCGCGGCGGCACCGAGATCGACCTCCAGCCGCGCGAA
TTCCGCCTTCTCGAACATCTGATGCGGGCCGCGGGGCGCGTGCAGACGCGCACGATGCTGCTCGAAGCGGTCTGGGATTT
CCATTTCGATCCCGGCACCAGCGTCGTCGAGACCCACATGAGCCGCCTGCGCGCCAAGATCGACCGGCCGTTCGACAAGC
CGCTGCTCCACACGGTCCGGGGCGCGGGCTACATGCTGAAGGCATGA

Protein sequence :

MENDMKILLAEDDRQTADYLRQGLLAEGYSVDHVPDGRDALVQATLQPYDLLVVDRMMPGLDGLSLVKALRSAQIKAPIL
ILTAMGGVTDRVEGLQAGADDYLVKPFAFSELSARLAALARRPALAEGARDLLRVGDLTLDTVRRTVSRGGTEIDLQPRE
FRLLEHLMRAAGRVQTRTMLLEAVWDFHFDPGTSVVETHMSRLRAKIDRPFDKPLLHTVRGAGYMLKA

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
copR	NP_460069.2	transcriptional regulatory protein YedW	Not tested	SPI-5	Protein	2e-38	47
copR	AAC33719.1	regulatory protein CopR	Not tested	SPI-5	Protein	3e-38	46

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
RSKD131_3419	YP_002520352.1	Two component transcriptional regulator, winged helix family	BAC0083	Protein	3e-44	52
RSKD131_3419	YP_002520352.1	Two component transcriptional regulator, winged helix family	BAC0638	Protein	4e-35	47
RSKD131_3419	YP_002520352.1	Two component transcriptional regulator, winged helix family	BAC0125	Protein	2e-39	46
RSKD131_3419	YP_002520352.1	Two component transcriptional regulator, winged helix family	BAC0111	Protein	2e-39	46
RSKD131_3419	YP_002520352.1	Two component transcriptional regulator, winged helix family	BAC0197	Protein	7e-38	46
RSKD131_3419	YP_002520352.1	Two component transcriptional regulator, winged helix family	BAC0347	Protein	3e-35	45
RSKD131_3419	YP_002520352.1	Two component transcriptional regulator, winged helix family	BAC0308	Protein	1e-39	43

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
RSKD131_3419	YP_002520352.1	Two component transcriptional regulator, winged helix family	VFG0596	Protein	6e-39	47
RSKD131_3419	YP_002520352.1	Two component transcriptional regulator, winged helix family	VFG1390	Protein	3e-34	46
RSKD131_3419	YP_002520352.1	Two component transcriptional regulator, winged helix family	VFG0473	Protein	2e-24	42
RSKD131_3419	YP_002520352.1	Two component transcriptional regulator, winged helix family	VFG1389	Protein	7e-27	41