Gene Information

Name : Hore_21640 (Hore_21640)
Accession : YP_002509905.1
Strain : Halothermothrix orenii H 168
Genome accession: NC_011899
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2356669 - 2357349 bp
Length : 681 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGGAGAAAATACTGGTTATAGATGATGAAGAGAATATCAGGGAGCTTATTAAATTTAATTTAGAGACGGCAGGTTACAG
GGTAGAACTGGCCGCTGATGGAGAAGAAGGTTGGGACAGGTTGAATGATTCCATAGATTTGATTATCCTTGACTTAATGT
TGCCCCGGATTGATGGACTGAGCTTCTGCCGGCAGGTCAGGTCCAATAACCGATTTAAAGATATTCCCATAATCATGTTA
ACTGCTAAAGGGGAAGAAGTGGACAAAATTATTGGGTTAGAAATGGGAGCAGATGATTATATAACCAAACCCTTTAGCCC
CCGGGAACTGGTTGCCAGGATTAAGGCCGTGCTCCGCAGAGTGCAAAAGAATGAAGAAAAGAGTGATAATGAGTTAATAA
AAAAAGCTGATTTTGAATTAGATGTATCCAGTCATGAAGCCCGTAAGGGAGGGGAGGTTTTAAACTTAACCCCTAAAGAA
TTTGATTTATTGCGTCATCTACTGGTAAATTCGGGTAAGGTATTAACCCGTGATATTCTACTTGAAAAAGTCTGGGGCTA
TGAATATGCAGGGGATACCAGAACTGTTGATGTTCATATAAGGAGGTTAAGAAGAAAGATCGGGGATAATTATATTGTTA
CCGTGAGAGGGGTGGGGTATAAATTTGTTAAACTGGAATGA

Protein sequence :
MEKILVIDDEENIRELIKFNLETAGYRVELAADGEEGWDRLNDSIDLIILDLMLPRIDGLSFCRQVRSNNRFKDIPIIML
TAKGEEVDKIIGLEMGADDYITKPFSPRELVARIKAVLRRVQKNEEKSDNELIKKADFELDVSSHEARKGGEVLNLTPKE
FDLLRHLLVNSGKVLTRDILLEKVWGYEYAGDTRTVDVHIRRLRRKIGDNYIVTVRGVGYKFVKLE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 8e-41 52
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-41 49
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-41 49
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-41 49
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-41 49
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-41 49
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-41 49
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-41 49
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-41 49
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-41 49
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-41 49
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-38 46
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-38 46
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-39 45
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 8e-36 44
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-27 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-27 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-27 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-27 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-27 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-27 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-27 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-27 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 6e-26 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 4e-27 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-33 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator BAC0039 Protein 2e-30 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 9e-31 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 2e-30 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 1e-30 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator BAC0596 Protein 9e-31 43
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 4e-28 42
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-28 42
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-26 42
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 7e-30 42
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 8e-31 42
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 8e-29 41
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 3e-31 41
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 5e-32 41
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 5e-32 41
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 1e-26 41
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 3e-32 41
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 5e-28 41
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 1e-26 41
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 3e-32 41
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-29 41
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 4e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Hore_21640 YP_002509905.1 winged helix family two component transcriptional regulator VFG1702 Protein 9e-31 41