Gene Information

Name : Hore_13280 (Hore_13280)
Accession : YP_002509073.1
Strain : Halothermothrix orenii H 168
Genome accession: NC_011899
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1427403 - 1428086 bp
Length : 684 bp
Strand : +
Note : PFAM: Transcriptional regulatory protein, C terminal; Response regulator receiver domain

DNA sequence :
TTGAACCCCAAAATACTGGTTGTAGATGATGAGAAAAAAATCAGGAAGGTCCTTAAGGCCTTCCTGGAAAAACATGATTT
TTCTATAGAAATGGCCAGTGATGGTAAGGAGGCCCTTTCTAAAGTAAATGAATTTAATCCAGATCTGATCATTCTTGATT
TAATGCTCCCTGAAATAAGTGGTGAAGAAGTCTGCCAGAAAATAAGGCAAGACAAACAGACTCCGATCCTGATGTTAACC
GCTAAAGGCACCGAGGAAGATAAAGTCAACGGTTTTGCTTATGGAGCCGATGATTACCTGGTCAAACCCTTCAGTCTTCG
GGAACTTTTAGCCCGAATTAAGGCAATTTTACGACGAAGTAACCAGAAGGCCGAAAAAGCAGAAATTTTTGTGTACCAGG
ATGGAAGGTTAAAAATTCATCCTAACAGAATGAAAGTATTAGTTAATGGTAGAGATGCTGACTTAACCAGAACCGAGTTC
AATATCTTAGTGACCCTGATCCGTAATCCCGGTCAGGTCTTTACCAGAGAACAGTTGGCCAAAAAAGTTATGGGCCTTGA
ATATAAAGGGTATGACCGGACAATCGATGCCCATATAAAAAATATCCGGAAAAAGCTTAATCTAGAAAAAAACCAACTTA
TTATAACTGTATATGGTGTCGGCTATAAATTTGAGGGGGATTAA

Protein sequence :
MNPKILVVDDEKKIRKVLKAFLEKHDFSIEMASDGKEALSKVNEFNPDLIILDLMLPEISGEEVCQKIRQDKQTPILMLT
AKGTEEDKVNGFAYGADDYLVKPFSLRELLARIKAILRRSNQKAEKAEIFVYQDGRLKIHPNRMKVLVNGRDADLTRTEF
NILVTLIRNPGQVFTREQLAKKVMGLEYKGYDRTIDAHIKNIRKKLNLEKNQLIITVYGVGYKFEGD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 6e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-37 48
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-37 48
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-37 48
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-37 48
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-37 48
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-37 48
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-37 48
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-37 48
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-37 48
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-37 47
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-36 47
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-33 45
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 4e-39 44
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 2e-35 44
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-36 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-36 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-36 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-36 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-36 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-36 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-36 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-36 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator BAC0596 Protein 1e-38 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator BAC0039 Protein 6e-39 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 1e-38 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 6e-39 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 8e-31 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator BAC0533 Protein 6e-31 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 1e-30 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 6e-31 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 1e-30 43
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 6e-33 42
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-30 42
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 6e-33 42
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 5e-39 42
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-32 42
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 2e-35 42
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 8e-38 41
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 5e-30 41
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-34 41
Hore_13280 YP_002509073.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 9e-38 41