
|
Name : Mnod_6108 (Mnod_6108) Accession : YP_002501235.1 Strain : Methylobacterium nodulans ORS 2060 Genome accession: NC_011894 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : L : Replication, recombination and repair COG ID : COG3316 EC number : - Position : 6219638 - 6220390 bp Length : 753 bp Strand : + Note : KEGG: met:M446_7034 hypothetical protein DNA sequence : ATGATCCTCAACGCCCTCGCCCTCAAGCTGAAGCGCCAAGCTCGCGGCGACTTCAAGGGCCGGCACTTCGAGGCCACGCT CATCGTCCAAGCTGTCTCCTGGTATCTGCGCTACGCCCTGAGCTACCGCGACATCGAGGAGATGCTGCTCGAACGCGGCC TGGAGGTGGATCACTCCACCCTCAATCGCTGGGTGCTCGCCTACGCGCCGGCCATCGAGCGCCGCTTACGCATGCTCCGC AAACCGCATTGCGGATCGGTGCGCGTCGACGAAACGTACATCTGCATCCGGGGCCAGTGGCGCTACCTGTACCGCGCCAT CGACAAGCACGGGGAGCCGGTCGACTTCCTCCTCACCGCCCACCGCGACCTGGACGCCGCCAAGCGCTTCTTCCGCAAGA TGCTCAAGGAGGAGCCGCTGCTCGCGCCGGATCGCATCGGCACCGATGGAGCCGGCCCCTACCCGCCGGCCATCGCCGAA AGCCACGAGGAGGGTCTGCTGCCCCGGGCACCGACCCACCACGTCACCAAGCACCTGCAGCAAGGGATCGAGAGCGACCA CTTCCGGGTCAAGCGGCCGATGCCCCGCGTGGGCGGGTTCCGCTCGTTCACCACGGGGCGGCGCACGATCCAGGGCTTCG AGGCCATGCTGTGGTTGCGCAAGGGCTTCGGGTTCGCGGGGGCGTGGACCGTGCGCGAGCAGAACCAACTGCTCGCGCAC TGCTTCGGACTTCCCGTCGCGAACAAAGCGTGA Protein sequence : MILNALALKLKRQARGDFKGRHFEATLIVQAVSWYLRYALSYRDIEEMLLERGLEVDHSTLNRWVLAYAPAIERRLRMLR KPHCGSVRVDETYICIRGQWRYLYRAIDKHGEPVDFLLTAHRDLDAAKRFFRKMLKEEPLLAPDRIGTDGAGPYPPAIAE SHEEGLLPRAPTHHVTKHLQQGIESDHFRVKRPMPRVGGFRSFTTGRRTIQGFEAMLWLRKGFGFAGAWTVREQNQLLAH CFGLPVANKA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| tnpA6100 | ACN81001.1 | transposase | Not tested | AbaR5 | Protein | 8e-41 | 45 |
| tnpA6100 | ACN62081.1 | TnpA6100 | Not tested | SGI1 | Protein | 6e-41 | 45 |
| tpnIS26 | ADZ05778.1 | transposase | Not tested | AbaR12 | Protein | 3e-33 | 45 |
| tpnIS26 | ADZ05794.1 | transposase | Not tested | AbaR16 | Protein | 3e-33 | 45 |
| tnpA6100 | AGK07042.1 | IS6100 transposase | Not tested | SGI1 | Protein | 7e-41 | 45 |
| CDBH8_0916 | YP_005160008.1 | transposase-like protein | Not tested | Not named | Protein | 9e-41 | 45 |
| tnpA6100 | AGK07113.1 | IS6100 transposase | Not tested | SGI1 | Protein | 7e-41 | 45 |
| tnpA | AAG03007.1 | transposase | Not tested | SGI1 | Protein | 7e-41 | 45 |
| tnp6100 | ACS32049.1 | Tnp6100 | Not tested | SGI2 | Protein | 7e-41 | 45 |
| tnpA6100 | AGF34993.1 | IS6100 transposase | Not tested | SGI1 | Protein | 7e-41 | 45 |
| tnp6100 | ACX47960.1 | tnp6100 | Not tested | SGI1 | Protein | 4e-41 | 45 |
| tnpA6100 | AGF35032.1 | IS6100 transposase | Not tested | SGI1 | Protein | 7e-41 | 45 |
| tnpA6100 | AGK07018.1 | IS6100 transposase | Not tested | SGI1 | Protein | 4e-41 | 45 |
| tnpA6100 | AGF35067.1 | IS6100 transposase | Not tested | SGI1 | Protein | 7e-41 | 45 |
| tnpA6100 | AGK07076.1 | IS6100 transposase | Not tested | SGI1 | Protein | 4e-41 | 45 |
| tnpA6100 | AGK06937.1 | IS6100 transposase | Not tested | SGI1 | Protein | 7e-41 | 45 |
| tnpA6100 | AGK06983.1 | IS6100 transposase | Not tested | SGI1 | Protein | 7e-41 | 45 |
| tnpA26 | ADK35781.1 | transposase of IS26 | Not tested | AbaR8 | Protein | 3e-33 | 45 |
| tpnIS26 | ADZ05796.1 | transposase | Not tested | AbaR17 | Protein | 3e-33 | 45 |
| tpnIS26 | ADZ05798.1 | transposase | Not tested | AbaR18 | Protein | 3e-33 | 45 |
| tpnIS26 | ADZ05784.1 | transposase | Not tested | AbaR14 | Protein | 7e-33 | 45 |
| tpnIS26 | ADZ05810.1 | transposase | Not tested | AbaR20 | Protein | 3e-33 | 45 |
| tnpA26 | AFV53109.1 | transposase of IS26 | Not tested | AbGRI2-1 | Protein | 3e-33 | 45 |
| tnp26 | AGK36641.1 | transposase of IS26 | Not tested | AbaR26 | Protein | 3e-33 | 45 |
| tnp26 | AGK36639.1 | transposase of IS26 | Not tested | AbaR26 | Protein | 3e-33 | 45 |
| tnpA26 | ACV89829.1 | transposase of IS26 | Not tested | AbaR6 | Protein | 3e-33 | 45 |
| Pmu_03480 | YP_005176246.1 | IS26 transposase | Not tested | ICEPmu1 | Protein | 4e-33 | 45 |
| tnpA26 | ACV89831.1 | transposase of IS26 | Not tested | AbaR7 | Protein | 3e-33 | 45 |
| tnpA26 | ACN81016.1 | transposase of IS26 | Not tested | AbaR5 | Protein | 4e-33 | 45 |
| tnpA26 | AFV53107.1 | transposase of IS26 | Not tested | AbGRI2-1 | Protein | 3e-33 | 45 |
| tnpA | AET25383.1 | TnpA | Not tested | PAGI-2(C) | Protein | 3e-33 | 45 |
| tnpA26 | AFV53108.1 | transposase of IS26 | Not tested | AbGRI2-1 | Protein | 3e-33 | 45 |
| tnpA | AFG30106.1 | TnpA | Not tested | PAGI-2 | Protein | 3e-33 | 45 |
| tnpA26 | AFV53110.1 | transposase of IS26 | Not tested | AbGRI2-1 | Protein | 3e-33 | 45 |
| tnpA26 | AGK07034.1 | IS26 transposase | Not tested | SGI1 | Protein | 3e-33 | 45 |
| tnpA26 | AFV53122.1 | transposase of IS26 | Not tested | AbGRI2-1 | Protein | 3e-33 | 45 |
| tnpA26 | AGK07037.1 | IS26 transposase | Not tested | SGI1 | Protein | 3e-33 | 45 |
| tnpA26 | ACK44541.1 | TnpA | Not tested | SGI1 | Protein | 3e-33 | 45 |
| tnpA26 | AGK07039.1 | IS26 transposase | Not tested | SGI1 | Protein | 3e-33 | 45 |
| tnpA26 | ACK44543.1 | TnpA | Not tested | SGI1 | Protein | 3e-33 | 45 |
| tnpA26 | AGK07092.1 | IS26 transposase | Not tested | SGI1 | Protein | 3e-33 | 45 |
| Pmu_03450 | YP_005176243.1 | IS26 transposase | Not tested | ICEPmu1 | Protein | 5e-33 | 45 |
| tnpA26 | AGK07095.1 | IS26 transposase | Not tested | SGI1 | Protein | 3e-33 | 45 |
| tpnIS26 | ADZ05788.1 | transposase | Not tested | AbaR15 | Protein | 3e-33 | 45 |
| tnpA26 | ACN81018.1 | transposase of IS26 | Not tested | AbaR5 | Protein | 5e-33 | 45 |
| tnpA26 | AGK07097.1 | IS26 transposase | Not tested | SGI1 | Protein | 3e-33 | 45 |
| tpnIS26 | ADZ05800.1 | transposase | Not tested | AbaR19 | Protein | 3e-33 | 45 |
| tnpA26 | ACN81013.1 | transposase of IS26 | Not tested | AbaR5 | Protein | 5e-33 | 45 |
| ABTW07_3872 | YP_005797120.1 | transposase of IS15DI, IS6 family | Not tested | AbaR4e | Protein | 4e-33 | 45 |
| ABTW07_3875 | YP_005797123.1 | transposase of IS15DI, IS6 family | Not tested | AbaR4e | Protein | 4e-33 | 45 |
| ABTW07_3890 | YP_005797138.1 | transposase of IS15DI, IS6 family | Not tested | AbaR4e | Protein | 4e-33 | 45 |
| ABTW07_3906 | YP_005797154.1 | transposase of IS15DI, IS6 family | Not tested | AbaR4e | Protein | 4e-33 | 45 |
| IS26 | CAJ77078.1 | Insertion sequence | Not tested | AbaR1 | Protein | 3e-33 | 45 |
| tnp7109-28 | YP_001800928.1 | transposase for insertion sequence | Not tested | Not named | Protein | 4e-33 | 45 |
| unnamed | AEZ06025.1 | TnpA26, Transposase of IS26 | Not tested | AbaR24 | Protein | 3e-33 | 45 |
| tnp7109-29 | YP_001800930.1 | transposase for insertion sequence | Not tested | Not named | Protein | 4e-33 | 45 |
| IS26 | CAJ77074.1 | Insertion sequence | Not tested | AbaR1 | Protein | 3e-33 | 45 |
| tnpA | CAJ77056.1 | Transposase | Not tested | AbaR1 | Protein | 6e-41 | 43 |