Gene Information

Name : Mnod_5481 (Mnod_5481)
Accession : YP_002500628.1
Strain : Methylobacterium nodulans ORS 2060
Genome accession: NC_011894
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5587688 - 5588374 bp
Length : 687 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: met:M446_0275 two component transcriptional regulator

DNA sequence :

ATGCGTCTCCTGATCATCGAGGACGACCGCGAGGCGGCGTCCTATCTCTCGAAAGCTTTTCGCGAGGCCGGCCACGTGGC
GGATCTCGCCGCCGACGGGCTCGACGGCTATGCGCTCGCCCGCGAGGGGGATTACGACGTGCTCGTGGTCGACCGCATGC
TGCCGAAGCTCGACGGACTCTCGCTGATCCGGTCGCTGCGCGAGCAGGGCGTCGAGACGCCGGTCCTGATCCTCTCGGCG
CTGGGGCAGGTCGACGACCGGGTGAAGGGCCTGCGGGCCGGGGGCGACGACTACCTGCCGAAGCCCTATGCCTTCTCGGA
ACTCCTCGCCCGGATCGAGGTTCTGGCGCGCCGCCGCGGGGGAGGGGCGGGCGAGCCGACCGCCTACCGGGTCGGCGACC
TCGAACTCGACCGGCTGTCGCACCGCGTCACCCGCGGAGGCCAGGAGATCGTGCTCCAGCCGCGCGAGTTCCGCCTGCTC
GAATACCTGATGCGCCATGCCGGGCAGGTCGTGACCCGCACGATGCTGCTCGAACACGTCTGGGACTACCACTTCGATCC
GCAGACCAACGTCATCGACGTCCATGTCTCGCGCCTGCGCGCCAAGGTGGACAAGGGGTTCGAGCGGCCGATGATCCACA
CGGTACGGGGTGCCGGCTACATGGTCCGGGCCGGCGGCGAGGGGTGA

Protein sequence :

MRLLIIEDDREAASYLSKAFREAGHVADLAADGLDGYALAREGDYDVLVVDRMLPKLDGLSLIRSLREQGVETPVLILSA
LGQVDDRVKGLRAGGDDYLPKPYAFSELLARIEVLARRRGGGAGEPTAYRVGDLELDRLSHRVTRGGQEIVLQPREFRLL
EYLMRHAGQVVTRTMLLEHVWDYHFDPQTNVIDVHVSRLRAKVDKGFERPMIHTVRGAGYMVRAGGEG

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
copR	NP_460069.2	transcriptional regulatory protein YedW	Not tested	SPI-5	Protein	6e-34	43
copR	AAC33719.1	regulatory protein CopR	Not tested	SPI-5	Protein	6e-33	42

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Mnod_5481	YP_002500628.1	winged helix family two component transcriptional regulator	BAC0125	Protein	6e-44	50
Mnod_5481	YP_002500628.1	winged helix family two component transcriptional regulator	BAC0111	Protein	3e-49	50
Mnod_5481	YP_002500628.1	winged helix family two component transcriptional regulator	BAC0083	Protein	2e-46	49
Mnod_5481	YP_002500628.1	winged helix family two component transcriptional regulator	BAC0347	Protein	1e-42	48
Mnod_5481	YP_002500628.1	winged helix family two component transcriptional regulator	BAC0638	Protein	2e-37	47
Mnod_5481	YP_002500628.1	winged helix family two component transcriptional regulator	BAC0308	Protein	7e-41	46
Mnod_5481	YP_002500628.1	winged helix family two component transcriptional regulator	BAC0197	Protein	3e-39	45
Mnod_5481	YP_002500628.1	winged helix family two component transcriptional regulator	NC_002516.2.879194.p	Protein	3e-26	44

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
Mnod_5481	YP_002500628.1	winged helix family two component transcriptional regulator	VFG1389	Protein	1e-33	45
Mnod_5481	YP_002500628.1	winged helix family two component transcriptional regulator	VFG0596	Protein	2e-34	43
Mnod_5481	YP_002500628.1	winged helix family two component transcriptional regulator	VFG1390	Protein	4e-36	43
Mnod_5481	YP_002500628.1	winged helix family two component transcriptional regulator	VFG0473	Protein	4e-27	42