Gene Information

Name : Mnod_4340 (Mnod_4340)
Accession : YP_002499516.1
Strain : Methylobacterium nodulans ORS 2060
Genome accession: NC_011894
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 4383771 - 4384127 bp
Length : 357 bp
Strand : +
Note : PFAM: IS66 Orf2 family protein; KEGG: met:M446_1473 IS66 Orf2 family protein

DNA sequence :
ATGATCGGGCCGGCTGGGACAGTGCGCGTGATGCTGGCGACGCGGCCGGTGGACTTCCGCAAAGGTATCGACGGGCTGGC
CGCGCTGGTGCGCGAGGCGATGGGCGCGGATCCGTTCTCCGGCACGGTCTATGTGTTCCGCTCGAAGCGGGCAGATCGGA
CCAAGCTTTTGTTCTGGGATGGAAGCGGGGTGGTTCTCGCGGCCAAGCGTCTGGAGGACGGTCAATTCTGCTGGCCGAAG
GCTCAGGACGGCGTCGTGCGCCTCACGGCTGCGCAGCTCTCGGCCCTGCTCGAAGGGCTGGACTGGAAGCGTGTCCACGA
GGCTCGTCAGGTGAGCGCGCCAGCGGTGGCAGGCTGA

Protein sequence :
MIGPAGTVRVMLATRPVDFRKGIDGLAALVREAMGADPFSGTVYVFRSKRADRTKLLFWDGSGVVLAAKRLEDGQFCWPK
AQDGVVRLTAAQLSALLEGLDWKRVHEARQVSAPAVAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 4e-21 52
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 4e-19 47
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-19 47
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-17 47
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-17 47
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-17 47
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-17 47
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-17 47
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-16 47
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-17 47
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-16 47
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-17 47
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-17 47
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-18 46
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-17 46
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-17 46
EXB18 ABD94704.1 ISPpu14 transposase Orf2 Not tested ExoU island B Protein 9e-11 46
unnamed ABR13518.1 transposase Not tested PAGI-7 Protein 6e-11 46
unnamed AAL08461.1 unknown Not tested SRL Protein 6e-17 45
RL060 AAP84185.1 transposase Not tested PAPI-1 Protein 1e-10 45
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-11 44
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 6e-19 41
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 6e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mnod_4340 YP_002499516.1 IS66 Orf2 family protein VFG1709 Protein 1e-17 47
Mnod_4340 YP_002499516.1 IS66 Orf2 family protein VFG0792 Protein 1e-17 47
Mnod_4340 YP_002499516.1 IS66 Orf2 family protein VFG1665 Protein 4e-19 46
Mnod_4340 YP_002499516.1 IS66 Orf2 family protein VFG1698 Protein 8e-18 46
Mnod_4340 YP_002499516.1 IS66 Orf2 family protein VFG1052 Protein 2e-17 45
Mnod_4340 YP_002499516.1 IS66 Orf2 family protein VFG1517 Protein 6e-12 44