Gene Information

Name : Mnod_2765 (Mnod_2765)
Accession : YP_002498020.1
Strain : Methylobacterium nodulans ORS 2060
Genome accession: NC_011894
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2840558 - 2841223 bp
Length : 666 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: met:M446_6140 two component transcriptional regulator

DNA sequence :
ATGCGGGTGCTGGTCGTCGAGGACGATGCCGCCCTGGCCCGGGGATTGGTGGCGGCGCTCCGGCTCGCCGGGCTGGCGGT
GGACCACGAGGCCGACGGGGCCGAGGCGGCGAGGCTCGCGCTCTCCGAGCCCTACAGCCTGATCGTCCTCGATGTCGGCC
TGCCGGGCCTGTCCGGCTTCGAGGTGCTCCGCCGCATCCGCGCCGCGAAGAGCGCGGTCCCGGTGATGATCCTGACCGCC
CGGGACGCGGTGACGGACCGGGTGCGCGGGCTCGATCTCGGCGCCGACGACTACCTGCTCAAGCCGTTCGCACCGGCCGA
GTTCGAGGCGCGCGTCCGGGCCCTGATCCGGCGGGGCCAGGGCCTGCCGAACCCCGTGCTGCGCTGCGGGGCCCTCTCCC
TCGACCGCGCGACCGGGACGGTGACGCTCGGCGACGAGCCGGTGAGCCTGCGGCGCCGGGAACTCGCGGTGCTCACGGTG
CTGATGGCGCGGGCCGGACAGGTGGTGCCGAAGGAGCGGCTGAGCGGCGAGGTGTTCGGCTTCGACGAGGCGGTGGCCCC
CAACGCCCTCGAACTCTATGTCGCCCGCCTGCGCAAGAAGCTGCAGCCGAACGGACCGGAGATCCGCACCATCCGCGGCC
TCGGCTACCTTCTGGACGGCCGATGA

Protein sequence :
MRVLVVEDDAALARGLVAALRLAGLAVDHEADGAEAARLALSEPYSLIVLDVGLPGLSGFEVLRRIRAAKSAVPVMILTA
RDAVTDRVRGLDLGADDYLLKPFAPAEFEARVRALIRRGQGLPNPVLRCGALSLDRATGTVTLGDEPVSLRRRELAVLTV
LMARAGQVVPKERLSGEVFGFDEAVAPNALELYVARLRKKLQPNGPEIRTIRGLGYLLDGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 4e-33 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mnod_2765 YP_002498020.1 winged helix family two component transcriptional regulator BAC0487 Protein 2e-35 46
Mnod_2765 YP_002498020.1 winged helix family two component transcriptional regulator BAC0638 Protein 6e-29 44
Mnod_2765 YP_002498020.1 winged helix family two component transcriptional regulator BAC0083 Protein 9e-35 43
Mnod_2765 YP_002498020.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-33 43
Mnod_2765 YP_002498020.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 9e-29 43
Mnod_2765 YP_002498020.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 2e-24 42
Mnod_2765 YP_002498020.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 1e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mnod_2765 YP_002498020.1 winged helix family two component transcriptional regulator VFG1390 Protein 8e-31 44
Mnod_2765 YP_002498020.1 winged helix family two component transcriptional regulator VFG0473 Protein 1e-32 44
Mnod_2765 YP_002498020.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-32 42