Gene Information

Name : A2cp1_4151 (A2cp1_4151)
Accession : YP_002494534.1
Strain : Anaeromyxobacter dehalogenans 2CP-1
Genome accession: NC_011891
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4637034 - 4637726 bp
Length : 693 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ank:AnaeK_4125 two component transcriptional regulator, winged helix family

DNA sequence :
GTGACGTCCGTTCTCTTGGTGGACGACGAGCGAGACCTGCTCTCGCTCCTCGACTTCAACCTGCGCGCGTCCGGGTTCGA
GACGCTGCTCGCCACCACCGGCGAGCAGGCGCTCTCGCACCTCCGCCGCCGCGTGCCGGACCTCGTCCTGCTCGACGTCA
TGCTGCCCGACGTCTCGGGGACGGAGGTGTGCCGGCAGATCAAGTCCGACCCCCGCACCCGGCACGTCCCGGTGGTGATG
CTCACCGCCAAGGGCGACGAGGTGGACCGGGTGGTCGGCTTCGAGCTGGGCGCCGACGACTACGTGACCAAGCCGTTCAG
CGTGCGCGAGCTGGTGCTCCGGCTGAAGGCGGTGCTCCGCCGTGCCGGCGCGCGCCCGTCGGAGCGCCCGCCGGAGTCGG
TCGGGCCCATCCGCGTGGACGTGGAGTCCCACCGCGTCTACGTGGACGGCGCGGAGGTGGTGCTCACGCCGCTCGAGTTC
AAGCTGCTCACCACGCTCATGTCGCGGCTGGGCCGGGTGCAGTCGCGCGATCAGCTCCTCGAGGACGTGTGGGAGATGTC
CGCCGAGGTCGAGACGCGCACGGTGGACACGCACGTGAAGCGGCTCCGTGAGAAGCTGGGGTCGGGACGGGACCTGCTGG
AGACGGTGCGGGGGATCGGCTATCGCCTCGTGGATCCGAGCGAGAAGCGCTGA

Protein sequence :
MTSVLLVDDERDLLSLLDFNLRASGFETLLATTGEQALSHLRRRVPDLVLLDVMLPDVSGTEVCRQIKSDPRTRHVPVVM
LTAKGDEVDRVVGFELGADDYVTKPFSVRELVLRLKAVLRRAGARPSERPPESVGPIRVDVESHRVYVDGAEVVLTPLEF
KLLTTLMSRLGRVQSRDQLLEDVWEMSAEVETRTVDTHVKRLREKLGSGRDLLETVRGIGYRLVDPSEKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 2e-17 43
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 2e-17 43
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 2e-17 43
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 2e-17 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-29 46
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-33 44
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-33 44
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-33 44
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-33 44
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-33 44
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-33 44
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-33 44
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-33 44
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-33 44
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-33 44
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-27 42
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-24 42
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 3e-19 41
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 3e-22 41
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 1e-22 41
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 8e-23 41
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 1e-21 41
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator BAC0596 Protein 3e-22 41
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator BAC0039 Protein 1e-22 41
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 2e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator VFG1389 Protein 6e-19 42
A2cp1_4151 YP_002494534.1 winged helix family two component transcriptional regulator VFG1386 Protein 1e-20 41