Gene Information

Name : A2cp1_3106 (A2cp1_3106)
Accession : YP_002493507.1
Strain : Anaeromyxobacter dehalogenans 2CP-1
Genome accession: NC_011891
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3431780 - 3432484 bp
Length : 705 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ank:AnaeK_3000 two component transcriptional regulator, winged helix family

DNA sequence :
ATGACCGCCGCGACCCCGCTCCTGGCGCTGCTCGTCGAGGACGACCTCCGCCTGGCCGCGTTCACCCGCGAGTATCTCGA
GGGGCACGGCGTGGCGGTGGTCCACGCGACCGACGGGCGACGCGGCCTCGACGAGGCGCTCGGCGGCCGCTTCGACGTGG
TGCTGCTCGACCTCATGCTGCCGGGCAAGGACGGCCTGGAGGTCTGCCGCGAGCTCCGGTCGCGCTCCGACGTCCCCGTC
ATCGTCCTCACCGCGCGCGGCGAGGAGGCGGACCGCGTGATGGGCCTCGAGCTCGGCGCCGACGACTACCTGGCGAAGCC
GTTCTCGCCGCGCGAGCTGCTCGCGCGGATCCGCGCCGTGGTCCGGCGCGCCACCGGCCGCGCCGGGCCGCCGCGCGAGG
TGGTGCGGGTCGGCGGGCTGGTGGTGGACCCGGCGGCGCGCCGGGTGACGCTGGACGGGCGCGAGGTGGCGCTCACCGGG
TACGAGTTCGCGCTGCTGCACGCGCTGGCGCGCCGCGCGGGCCGGGTGCTCGCCCGGGAGCAGCTCATGGAGCTGGCCGG
CGGCAGCGCGGAGGAGGCGTTCGACCGCTCCGTGGACGTGCACGTCTCCCGGCTGCGGCAGAAGCTCGGCGACGATCCCC
GGCGGCCCCGCCTCATCAAGACGGTCCGCGGCGCCGGGTACCTGCTCGCCGGGGAACCGGGATGA

Protein sequence :
MTAATPLLALLVEDDLRLAAFTREYLEGHGVAVVHATDGRRGLDEALGGRFDVVLLDLMLPGKDGLEVCRELRSRSDVPV
IVLTARGEEADRVMGLELGADDYLAKPFSPRELLARIRAVVRRATGRAGPPREVVRVGGLVVDPAARRVTLDGREVALTG
YEFALLHALARRAGRVLAREQLMELAGGSAEEAFDRSVDVHVSRLRQKLGDDPRRPRLIKTVRGAGYLLAGEPG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-19 42
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 1e-14 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-25 46
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 3e-21 45
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 1e-20 45
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 1e-20 45
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 9e-32 44
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 7e-31 43
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-23 43
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-23 43
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-23 43
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-23 43
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-23 43
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-23 43
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-23 43
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-23 43
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-23 43
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-23 43
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-22 43
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 5e-19 43
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-18 42
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-17 42
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-17 42
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 8e-24 42
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-20 41
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 1e-24 41
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator BAC0347 Protein 5e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-18 46
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-19 44
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-19 42
A2cp1_3106 YP_002493507.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-24 41