Gene Information

Name : A2cp1_2539 (A2cp1_2539)
Accession : YP_002492942.1
Strain : Anaeromyxobacter dehalogenans 2CP-1
Genome accession: NC_011891
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 2813180 - 2813578 bp
Length : 399 bp
Strand : -
Note : PFAM: IS66 Orf2 family protein; KEGG: ank:AnaeK_3965 IS66 Orf2 family protein

DNA sequence :
GTGATCACCATCCCGCGCTCGGTGCGCATCTACATCGGCTCGACGCCGATCGACATGCGCAAGTCGATCGATGGCCTTCA
CGCGATCGTGCAGAACGAGCTCGCGAAGGACGCGTACTCGGGCCACCTGTTCGTCTTCGTCTCGCGGCGGTGGGACCGCG
TGAAGATCCTGACGTGGGACAAGGGCGGGTTCGTCTTGGTGTACAAGCGGCTCGAGCGCGGGCAGTTCAAGCTGCCCCAC
ATGGATCCATCGACGATGGCCGTCGAGATCGACGCGACACAGCTCGCGATGCTCCTCGACGGCATCGACTTCGGACGCGT
CCGCCGGCCTGAGCACTGGCAGCCGTCCCAGTCGGATCCTCAGGCCGCTCGTCCCATGGACAAGCCCGCTCCGGCGTGA

Protein sequence :
MITIPRSVRIYIGSTPIDMRKSIDGLHAIVQNELAKDAYSGHLFVFVSRRWDRVKILTWDKGGFVLVYKRLERGQFKLPH
MDPSTMAVEIDATQLAMLLDGIDFGRVRRPEHWQPSQSDPQAARPMDKPAPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 3e-14 48
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-13 48
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-13 48
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 3e-14 48
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-14 46
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-14 44
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-14 44
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 4e-17 44
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 6e-16 43
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 6e-16 43
unnamed AAL08461.1 unknown Not tested SRL Protein 4e-13 43
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-15 42
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 7e-13 42
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 7e-13 42
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-13 42
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-13 42
unnamed AAC31493.1 L0014 Not tested LEE Protein 5e-13 42
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-12 42
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 5e-13 42
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-12 42
unnamed AAL99258.1 unknown Not tested LEE Protein 5e-13 42
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 7e-13 42
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 5e-13 42
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 7e-13 42
unnamed AAF71493.1 unknown Not tested Hrp PAI Protein 2e-14 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
A2cp1_2539 YP_002492942.1 IS66 Orf2 family protein VFG1737 Protein 1e-14 46
A2cp1_2539 YP_002492942.1 IS66 Orf2 family protein VFG1052 Protein 2e-13 43
A2cp1_2539 YP_002492942.1 IS66 Orf2 family protein VFG1665 Protein 8e-16 42
A2cp1_2539 YP_002492942.1 IS66 Orf2 family protein VFG1709 Protein 2e-13 42
A2cp1_2539 YP_002492942.1 IS66 Orf2 family protein VFG0792 Protein 2e-13 42
A2cp1_2539 YP_002492942.1 IS66 Orf2 family protein VFG1698 Protein 2e-13 42