Gene Information

Name : Ddes_0567 (Ddes_0567)
Accession : YP_002479155.1
Strain : Desulfovibrio desulfuricans ATCC 27774
Genome accession: NC_011883
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 686249 - 686926 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: dvl:Dvul_1911 two component transcriptional regulator

DNA sequence :
ATGAGCCAACAGATATTGATAGTTGAAGATGAAGCCGACATTCGCGAGCTTTTGCGCTTTAATCTCGAGCGTGAGGGCTT
CAGCGTTCTGGAGGCGGCGGATGGCAACGAGGCGCTCAGGCTGGCCCGCCAGCATCTGCCGGACCTCATGCTGCTGGACG
TCATGATGCCCGGGCCGGACGGGTTCGAGATCTGCCGCCTTTTGGGGGCGCAGGCTGAAACCGCCCATATCCCCGTGCTT
ATGCTGACGGCCAGAGGCGAAGAAATGGACCGCGTGGTGGGCCTGAGCCTTGGCGCGGACGATTATGTGGTCAAACCTTT
CAGCGTGCGTGAGCTTATGCTGCGCATCCGGGCAGTGCTGCGGCGCGGGACGCGCAGCGGCGAAAGCCCGGTGCTGGAAC
GCCACGGCATACGCCTGCGCCCCGATGCCCATACGGCGGAGGCGCACGGCGAAGAACTGCAGTTGACAGCCACGGAGTTT
CGCCTGCTGGAAGACCTGCTGCGCCATGCCGGGTCGGTGCGCACGCGTGAGCAGCTGCTCAACAAGGTATGGGGCTATTC
CTTTGAAGGATATGCCCGCACGGTGGATACCCACGTGCGCCGCCTGCGCGCCAAGCTGGGGCATGCGGCCTCCATGCTGG
AGACCGTGCGCGGGGTAGGCTACAGGATAAAGGAATAG

Protein sequence :
MSQQILIVEDEADIRELLRFNLEREGFSVLEAADGNEALRLARQHLPDLMLLDVMMPGPDGFEICRLLGAQAETAHIPVL
MLTARGEEMDRVVGLSLGADDYVVKPFSVRELMLRIRAVLRRGTRSGESPVLERHGIRLRPDAHTAEAHGEELQLTATEF
RLLEDLLRHAGSVRTREQLLNKVWGYSFEGYARTVDTHVRRLRAKLGHAASMLETVRGVGYRIKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-36 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 1e-25 46
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-40 45
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 3e-28 45
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 6e-29 45
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 3e-28 45
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-40 45
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-40 45
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 7e-40 45
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-40 45
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-40 45
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-40 45
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-40 45
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-40 45
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-40 45
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 5e-36 44
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator BAC0533 Protein 8e-29 44
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 8e-29 44
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-32 43
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-32 43
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-27 43
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-32 43
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-32 43
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-32 43
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-32 43
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-32 43
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-32 43
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 9e-30 43
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator BAC0197 Protein 6e-24 43
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-29 43
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 5e-30 42
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-29 42
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-29 42
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-28 42
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 7e-35 42
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 3e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-36 43
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-35 42
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-30 42
Ddes_0567 YP_002479155.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-23 41