Gene Information

Name : CKR_2315 (CKR_2315)
Accession : YP_002472780.1
Strain : Clostridium kluyveri NBRC 12016
Genome accession: NC_011837
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2619744 - 2620562 bp
Length : 819 bp
Strand : -
Note : -

DNA sequence :
ATGCCCAGAAAGTTTGCGCGAAAGGAGCTCGCATTCGAGAATATGAATAACAAAGAAATACCGAAAGAAGCAATTCAAGC
ATCGAAAATTATAGAGGAGCTACTCGATAGTATATTAGTGGGTATATATTTGTACGGTTCTGCTGTTATGGGAGGATTAC
GCATTAATAGCGATGTAGATATTTTGGTTGTAATAAATCGTAGTTTATCTGAAAGAACTCGAAGAGATCTTACAGACAGA
CTAATGCTTATATCTGGGAAAATAGGAAACACAAAAGATATGAGACCTCTTGAAGTTACAGTCATTAATCAAAAAGATAT
TATTCCTTGGCATTTTCCTCCCAGATATGAATTTATGTACGGCGAGTGGCTAAGAGAGCAGTTTGAAAAGGGAGATATTC
CTGAGCCGACTTATGATCCGGATTTAGCAATACTTTTAGCACAACTAAGAAAAAATAGTATTAACCTTTTGGGACCAAAG
GCAACAGAAGTAATTGAGCCTGTGCCGATGACAGATATTCGAAAAGCAATTAAAGAATCGTTGCCCGGGTTGATAACTAG
CATTAAAGGTGACGAACGCAATGTGATTTTAACTTTAGCCAGAATGTGGGTGACAGCATCTACTGGTGAAATCAGATCAA
AAGATCTGGCAGCTGAATGGGCAATACCTCAATTACCTTATGAGCATGCCATTTTACTTGACAAAGCAAGAAAGGCTTAT
CTAGGAGGGTATATTGATAAGTGGAAAGGAATGGATTCTGAGGTGACTGAACTCGTTAATAATATGAAGAAGTCTATAGA
GTCTTCCCTTAATCTCTAA

Protein sequence :
MPRKFARKELAFENMNNKEIPKEAIQASKIIEELLDSILVGIYLYGSAVMGGLRINSDVDILVVINRSLSERTRRDLTDR
LMLISGKIGNTKDMRPLEVTVINQKDIIPWHFPPRYEFMYGEWLREQFEKGDIPEPTYDPDLAILLAQLRKNSINLLGPK
ATEVIEPVPMTDIRKAIKESLPGLITSIKGDERNVILTLARMWVTASTGEIRSKDLAAEWAIPQLPYEHAILLDKARKAY
LGGYIDKWKGMDSEVTELVNNMKKSIESSLNL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
spc1 YP_039523.1 streptomycin 3''-adenylyltransferase 1 Not tested Type-II SCCmec Protein 2e-76 65
ant(9) NP_370577.1 O-nucleotidylltransferase Not tested Type-II SCCmec Protein 2e-76 65
ant(9) NP_373289.1 O-nucleotidylltransferase(9) Not tested Type-II SCCmec Protein 2e-76 65
spC YP_190051.1 streptomycin 3''-adenylyltransferase Not tested Type-II SCCmec Protein 2e-76 65
ant(9) BAC57473.1 O-nucleotidyltransferase(9) Not tested Type-IIIinv SCCmec Protein 2e-76 65
spc BAA82204.1 O-nucleotydiltransferase(9) Not tested Type-II SCCmec Protein 2e-76 65
aadA2 ACF06158.1 aminoglycoside 3''-adenyltransferase Not tested Tn5036-like Protein 3e-35 44
aadA2 AAK02046.1 streptomycin/spectinomycin resistance protein Not tested SGI1 Protein 2e-35 44
aadA2 AGF35027.1 AadA2 aminoglycoside adenylyltransferase Not tested SGI1 Protein 2e-35 44
aadA25 YP_005176241.1 aminoglycoside 3''-O-adenyltransferase protein Not tested ICEPmu1 Protein 1e-36 42
aadA1 CAD92142.1 aminoglycoside adenyltransferase Not tested Not named Protein 1e-37 41
aadDA1 CAJ77087.1 Aminoglycoside 3-adenylyltransferase Not tested AbaR1 Protein 1e-37 41
aadA1 ACV89835.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR7 Protein 1e-37 41
unnamed AFV53113.1 AadA1 aminoglycoside (3') adenyltransferase Not tested AbGRI2-1 Protein 1e-37 41
aadA1 AGK36646.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR26 Protein 1e-37 41
aadA1 YP_005797133.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 1e-37 41
aadA1 YP_005797149.1 aminoglycoside 3'-adenyltransferase Not tested AbaR4e Protein 1e-37 41
aadA1 YP_006098376.1 aminoglycoside adenylyltransferase Not tested Tn2411 Protein 1e-37 41
aadA1 ACY75515.1 aminoglycoside adenyltransferase Not tested Tn6060 Protein 1e-37 41
aadA1 ACN81025.1 AadA1 aminoglycoside (3')(9) adenylyltransferase Not tested AbaR5 Protein 1e-37 41
aadA1 CAJ77048.1 Aminoglycoside adenylyltransferase Not tested AbaR1 Protein 9e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CKR_2315 YP_002472780.1 hypothetical protein NC_002745.1124325.p0 Protein 1e-76 65
CKR_2315 YP_002472780.1 hypothetical protein NC_002745.1125314.p0 Protein 1e-76 65
CKR_2315 YP_002472780.1 hypothetical protein GU235985.1.orf1.gene Protein 1e-76 65
CKR_2315 YP_002472780.1 hypothetical protein NC_009782.5559439.p0 Protein 1e-76 65
CKR_2315 YP_002472780.1 hypothetical protein NC_002758.1121631.p0 Protein 1e-76 65
CKR_2315 YP_002472780.1 hypothetical protein NC_002952.2859154.p0 Protein 1e-76 65
CKR_2315 YP_002472780.1 hypothetical protein NC_002745.1123578.p0 Protein 1e-76 65
CKR_2315 YP_002472780.1 hypothetical protein NC_002745.1124853.p0 Protein 1e-76 65
CKR_2315 YP_002472780.1 hypothetical protein NC_009782.5559472.p0 Protein 1e-76 65
CKR_2315 YP_002472780.1 hypothetical protein NC_002758.1120013.p0 Protein 1e-76 65
CKR_2315 YP_002472780.1 hypothetical protein NC_002952.2859153.p0 Protein 1e-76 65
CKR_2315 YP_002472780.1 hypothetical protein NC_002745.1122823.p0 Protein 1e-76 65
CKR_2315 YP_002472780.1 hypothetical protein AF174129.3.gene3.p01 Protein 4e-35 44
CKR_2315 YP_002472780.1 hypothetical protein AF294653.1.gene3.p01 Protein 9e-36 44
CKR_2315 YP_002472780.1 hypothetical protein EU118119.1.orf1.gene Protein 2e-35 44
CKR_2315 YP_002472780.1 hypothetical protein AJ704863.gene12.p01 Protein 1e-35 43
CKR_2315 YP_002472780.1 hypothetical protein AY139598.1.gene2.p01 Protein 2e-38 43
CKR_2315 YP_002472780.1 hypothetical protein U37105.2.gene4.p01 Protein 3e-36 43
CKR_2315 YP_002472780.1 hypothetical protein AY263741.gene.p01 Protein 1e-34 42
CKR_2315 YP_002472780.1 hypothetical protein AF047479.2.orf1.gene Protein 1e-35 42
CKR_2315 YP_002472780.1 hypothetical protein AJ628353.gene.p01 Protein 6e-30 42
CKR_2315 YP_002472780.1 hypothetical protein DQ865198.gene.p01 Protein 1e-38 42
CKR_2315 YP_002472780.1 hypothetical protein NC_010558.1.6275994. Protein 1e-38 42
CKR_2315 YP_002472780.1 hypothetical protein AM932669.1.gene3.p01 Protein 6e-38 41
CKR_2315 YP_002472780.1 hypothetical protein AJ584652.2.gene7.p01 Protein 3e-37 41
CKR_2315 YP_002472780.1 hypothetical protein Y18050.2.gene6.p01 Protein 8e-38 41
CKR_2315 YP_002472780.1 hypothetical protein AY123251.gene3.p01 Protein 6e-38 41
CKR_2315 YP_002472780.1 hypothetical protein NC_010410.6003168.p0 Protein 6e-38 41
CKR_2315 YP_002472780.1 hypothetical protein JN596991.2.gene3.p01 Protein 8e-38 41
CKR_2315 YP_002472780.1 hypothetical protein FR748153.1.gene5.p01 Protein 8e-38 41
CKR_2315 YP_002472780.1 hypothetical protein AF313471.1.gene3.p01 Protein 6e-38 41
CKR_2315 YP_002472780.1 hypothetical protein AY339625.2.gene17.p0 Protein 6e-38 41
CKR_2315 YP_002472780.1 hypothetical protein NC_010410.6003170.p0 Protein 6e-38 41