Gene Information

Name : Cagg_0393 (Cagg_0393)
Accession : YP_002461774.1
Strain : Chloroflexus aggregans DSM 9485
Genome accession: NC_011831
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 486831 - 487514 bp
Length : 684 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rca:Rcas_1504 two component transcriptional regulator

DNA sequence :
ATGGCTTTTGTGTTGGTAGTTGACGATGATCCCGGCATTGTGCGGTTGGTTCGCTCATACCTTGAACAGGCCGGCTTTCG
GGTTGCGAGTGCATTCGATGGGGCGACTGCGCGTCGCCTCATCCGTCAGGAACGACCCGATCTGGTTATTCTCGATCTGA
TGTTGCCGGACGAAGATGGGTTTGACATTGCCCGTTCGCTACGCTCTGATCCCGCGACAGCGACTCTCCCGATCATTATG
CTCACCGCTCGTATTGACGACACCGACCGTATTGTCGGACTAGAGTTAGGCGCTGACGACTACATCGTCAAGCCCTTCAA
TCCGCGAGAAGTGGTAGCACGGGTGAAAGCCGTTTTACGACGTGTAAGTGGTGGGACGGTGCGTAATCGGTTAGAGCAGG
GTAGTCTCGTGCTCGATCTCGATGGGCATCAGGCGTGGTTAGGCGGTAACGAACTTGAGTTAACGCCTACGGAGTTTGCT
CTGCTTAGCCTATTTATGCGCTATCCGGGACACGCCTTTACGCGGGCTGAGCTACTCGAACAGGGGTTAGGTTATGCTGC
GACTGGGTTGGAGCGAACGATTGACAGTCATATCAAGAATCTGCGGAAGAAGCTCGAATACGATCCTGCGGCGCCGGTGA
TTGAGACGGTGTATGGGATCGGTTATCGTTTGCGAACGGTATGA

Protein sequence :
MAFVLVVDDDPGIVRLVRSYLEQAGFRVASAFDGATARRLIRQERPDLVILDLMLPDEDGFDIARSLRSDPATATLPIIM
LTARIDDTDRIVGLELGADDYIVKPFNPREVVARVKAVLRRVSGGTVRNRLEQGSLVLDLDGHQAWLGGNELELTPTEFA
LLSLFMRYPGHAFTRAELLEQGLGYAATGLERTIDSHIKNLRKKLEYDPAAPVIETVYGIGYRLRTV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-30 46
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-30 46
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-30 46
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-30 46
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-30 46
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-30 46
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-30 46
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-30 46
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-30 46
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-30 46
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-32 45
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-33 44
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-35 43
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 8e-35 43
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-35 43
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 7e-32 43
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator BAC0596 Protein 7e-32 43
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 3e-32 43
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator BAC0039 Protein 3e-32 43
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 1e-31 43
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 7e-32 43
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 3e-32 43
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 3e-31 43
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 1e-29 42
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 1e-18 42
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 4e-22 41
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 7e-25 41
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 5e-25 41
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 5e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator VFG1563 Protein 3e-31 41
Cagg_0393 YP_002461774.1 winged helix family two component transcriptional regulator VFG1386 Protein 7e-27 41