Gene Information

Name : Cagg_3265 (Cagg_3265)
Accession : YP_002464559.1
Strain : Chloroflexus aggregans DSM 9485
Genome accession: NC_011831
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3956878 - 3957615 bp
Length : 738 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cau:Caur_2437 response regulator receiver

DNA sequence : 
GTGAACACAACCGAAGAAACCGTACACCTGATCAACGAGGGGCGCGAGTTGCATGTCGTGGTCATCGAAGATGAGTTGAC
GATTGCCGAGTCGTTACGAGTTGGCCTTACCTATGAGGGTATGCGGGTAACAGTTGCTTCTGAAGGGCGGAGTGCTCTTC
AAATCGTTGAAGAGCAGGGAGCCGATCTTGTTATTCTCGATTTAATGTTACCTGACATTGATGGCATGGTTGTTTGTCGG
CGGTTGCGTGCATGGTCGGAGAAATTGCCTATCATCATCCTGACTGCGCGCGGTGAAGTGCAAGAACGGGTGAAAGGCTT
GCAATTGGGAGCCGACGATTACATTGTCAAACCGTTCAGTTTCGATGAATTACTGGCGCGGGTGAATGCTATTTTTCGAC
GGGCGGGCATCTCACGTCCGGTAACGGTACTGCAGGTAGCCGGACTGAGCCTTAATCTGGAGACGCGCGAAGTAACGCTG
CATGGTCGCGCTATCGAATTGACGCCGACCGAGTTTGCATTACTCGAACAATTTATGCGTCATCCACGACGTGTTTTCAC
CCGCCAGACCTTACTGAGTCGGGTGTGGGGGTTTACTTACGTCGGTGATTCGAACATCGTCGAAGTTCATATCAGCAATC
TTCGCGAGAAAATTGGAGATCATGAGCGGAAACTCATTCGCACCGTCTACGGTGTCGGTTATACCTTGCGACCCGACGAT
GAAACAATGGTGGCATAA

Protein sequence : 
MNTTEETVHLINEGRELHVVVIEDELTIAESLRVGLTYEGMRVTVASEGRSALQIVEEQGADLVILDLMLPDIDGMVVCR
RLRAWSEKLPIIILTARGEVQERVKGLQLGADDYIVKPFSFDELLARVNAIFRRAGISRPVTVLQVAGLSLNLETREVTL
HGRAIELTPTEFALLEQFMRHPRRVFTRQTLLSRVWGFTYVGDSNIVEVHISNLREKIGDHERKLIRTVYGVGYTLRPDD
ETMVA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-40 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-35 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-39 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-35 42
ef0091 AAM75294.1 EF0091 Not tested Not named Protein 1e-31 41
EF0571 NP_814337.1 DNA-binding response regulator Not tested Not named Protein 2e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-39 46
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator BAC0111 Protein 5e-40 45
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-38 44
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-37 44
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-40 44
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-40 43
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-40 43
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 7e-40 43
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-40 43
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-40 43
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-40 43
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-40 43
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-40 43
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-40 43
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-34 43
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-36 43
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-35 43
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-38 41
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-38 41
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-38 41
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-38 41
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-38 41
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-38 41
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-38 41
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-38 41
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 7e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-45 45
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator VFG1386 Protein 6e-39 44
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-40 43
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-35 42
Cagg_3265 YP_002464559.1 winged helix family two component transcriptional regulator VFG1702 Protein 9e-40 42