Gene Information

Name : Cagg_0243 (Cagg_0243)
Accession : YP_002461627.1
Strain : Chloroflexus aggregans DSM 9485
Genome accession: NC_011831
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 305086 - 305793 bp
Length : 708 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cau:Caur_3391 response regulator receiver

DNA sequence :
ATGGAAGCAGCGACGATTTTGGTGGTTGATGATGAACAACCGATTGTCGATTTGGTAAGTAGTTACCTTATCAATGAAGG
GTTTATCGTACATCGTGCGTTTGACGGGCCGAGTGCGTTGGCTTTGGCACGTAGTGTGAAACCCGATCTCGTAATTCTCG
ACATTATGCTGCCCGGTCTTGATGGGATCGAGGTTTGTCGGCAATTGCACCGGGAAACGACCGTCTACGTGTTGATGTTA
ACGGCCCGCGCCGATGAGATCGATAAGCTGATCGGCCTGTCAGTAGGGGCCGATGATTATTTGACGAAGCCGTTTAGCCC
GCGCGAACTGGTGGCACGGGTTAAAGCTATTTTACGCCGTAACCGTGCGGCCCGTGTGCTCGATGTTCATCAACGCCCGG
TTTTGCAATTTGCCGGTCTGCTGATCGATCCCGAACGTCGGGAGGTGGAGCGTAATGGGATACGAGTTGATCTGACACCG
CGTGAATTTGACCTGCTCTATACGTTGGCGAGTTATCCGGGCCGGGTGTTTACCCGAGAAGAGTTGCTGCAACGGGTATG
GGGTCCCGATTTTGCCGGTATTGATCGAGTGGTTGATGTCCATATCGGTACGTTACGGCGCAAACTTGATGATGACCAAC
ACGGTACGCCGCTTGTGCAGACGGTGCGCGGCGTAGGGTATAAGTTTGTCGGCGGCACACGATCATGA

Protein sequence :
MEAATILVVDDEQPIVDLVSSYLINEGFIVHRAFDGPSALALARSVKPDLVILDIMLPGLDGIEVCRQLHRETTVYVLML
TARADEIDKLIGLSVGADDYLTKPFSPRELVARVKAILRRNRAARVLDVHQRPVLQFAGLLIDPERREVERNGIRVDLTP
REFDLLYTLASYPGRVFTREELLQRVWGPDFAGIDRVVDVHIGTLRRKLDDDQHGTPLVQTVRGVGYKFVGGTRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-37 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-30 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-36 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-46 49
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-46 49
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-46 49
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-46 49
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-46 49
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-46 49
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-46 49
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-46 49
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-46 48
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-46 48
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 4e-44 48
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 4e-40 48
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-43 47
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-47 46
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-48 45
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 8e-43 44
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 5e-42 44
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 7e-38 44
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 9e-47 43
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 1e-41 43
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-31 43
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 1e-31 43
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-32 42
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 5e-34 42
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator BAC0533 Protein 2e-34 42
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 1e-34 42
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 2e-34 42
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 1e-34 42
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 5e-37 42
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 5e-41 42
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 1e-34 42
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-35 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-35 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-35 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-35 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-35 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-35 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-35 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-35 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 4e-36 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 1e-39 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 1e-39 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-29 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator BAC0638 Protein 6e-25 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator BAC0039 Protein 8e-42 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 9e-41 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 4e-41 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator BAC0596 Protein 1e-41 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 8e-42 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 7e-42 41
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 1e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-31 46
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator VFG1390 Protein 6e-40 44
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator VFG1386 Protein 1e-34 44
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-37 43
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator VFG0596 Protein 6e-31 42
Cagg_0243 YP_002461627.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-36 42