Gene Information

Name : Dhaf_0636 (Dhaf_0636)
Accession : YP_002457137.1
Strain : Desulfitobacterium hafniense DCB-2
Genome accession: NC_011830
Putative virulence/resistance : Resistance
Product : XRE family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG3655
EC number : -
Position : 708963 - 709190 bp
Length : 228 bp
Strand : +
Note : PFAM: hypothetical protein; KEGG: cth:Cthe_1655 hypothetical protein

DNA sequence :
ATGGCTATCAGCTATAACAAGCTATGGAAACTATTAATCGATAAGGGTATGAACAAGCAAGAATTGAAACAGTTATCGGG
CATCAGCACGACATCTATCGCGAAATTAGGTAAAGGCGAAAATATCACAACCGATGTATTACTGAAAATATGTAAAGCCC
TTAACTGCGATATCGCTGATATTATGGAAGTTGTGCCGGATCCGTTGGCCGGAAAAGTTTCTGAGTAA

Protein sequence :
MAISYNKLWKLLIDKGMNKQELKQLSGISTTSIAKLGKGENITTDVLLKICKALNCDIADIMEVVPDPLAGKVSE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
cpfrc_01461 YP_003783861.1 hypothetical protein Not tested PiCp 5 Protein 1e-13 50
CpC231_1455 YP_005683818.1 hypothetical protein Not tested PiCp 5 Protein 8e-14 50
CpI19_1462 YP_005685904.1 hypothetical protein Not tested PiCp 5 Protein 8e-14 50
Cp1002_1456 YP_005681720.1 hypothetical protein Not tested PiCp 5 Protein 3e-13 49
EFAU085_00700 YP_008394224.1 putative transcriptional regulator Not tested Not named Protein 5e-13 42
SPN23F_09520 YP_002510935.1 regulatory protein Not tested PPI-1 Protein 3e-08 41
SP_1030 NP_345505.1 hypothetical protein Not tested PPI-1 Protein 3e-08 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dhaf_0636 YP_002457137.1 XRE family transcriptional regulator DQ212986.1.gene3.p01 Protein 2e-16 56