Gene Information

Name : Dhaf_4050 (Dhaf_4050)
Accession : YP_002460496.1
Strain : Desulfitobacterium hafniense DCB-2
Genome accession: NC_011830
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4298746 - 4299429 bp
Length : 684 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: chy:CHY_2047 DNA-binding response regulator

DNA sequence :
GTGGCCGTAATTTTGGTGGTTGATGACGAAGAACCAATTCAGGAGCTGCTCAAGTTTAATCTTGAGAAAGAAGGCTACCA
GGTATTGATGGCGGCAGACGGGTCTGAAGCGTTGCGCATTCTTGAGGAAAAACAACCGGAGCTTGTGGTTCTTGACATTA
TGCTTCCCGGTATAAGCGGTCTGGAAGTATTGAATCAAATCCGCAAGACCCCCAAGTTTGTTGAACTGCCGGTCATTATG
CTGACAGCAAAAGGGGAAGAGATTGATAAAGTATTGGGGCTGGAGATCGGCGCCGATGATTATATTACGAAGCCTTTCAG
CCCCAGAGAGCTGATCGCCAGAATCCGGGCCAGGCTGAGGCGTCTCAAGCCTTCGGAGGAGAACAACGATATCCTTCGCC
AGGATCTGCATATTGATTTGGACCGTTTCCGAGTATCCGTTCGGGGAGAGTACATAGAATTAACACCGAAAGAATTTGAA
CTGCTGCGTGTCCTGGCCACCTATCCCGGTAAAGTCTATACCCGGGATGAGCTCCTGGAACGAATCTGGGGATATGAATA
CGCAGGGGATACACGAACCGTGGATGTCCATGTACGGCATCTCAGGCAAAAGATTGAGAAAGACCCTTCAAATCCTGAAT
ATATCGAAACATTGCGCGGTATCGGGTATCGTTTGAAAGGATAG

Protein sequence :
MAVILVVDDEEPIQELLKFNLEKEGYQVLMAADGSEALRILEEKQPELVVLDIMLPGISGLEVLNQIRKTPKFVELPVIM
LTAKGEEIDKVLGLEIGADDYITKPFSPRELIARIRARLRRLKPSEENNDILRQDLHIDLDRFRVSVRGEYIELTPKEFE
LLRVLATYPGKVYTRDELLERIWGYEYAGDTRTVDVHVRHLRQKIEKDPSNPEYIETLRGIGYRLKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-35 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-35 44
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_012469.1.7685629. Protein 6e-47 53
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_002952.2859905.p0 Protein 4e-47 52
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_003923.1003749.p0 Protein 4e-47 52
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_009782.5559369.p0 Protein 5e-47 51
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_002951.3237708.p0 Protein 5e-47 51
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_002758.1121668.p0 Protein 5e-47 51
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_007622.3794472.p0 Protein 3e-47 51
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_009641.5332272.p0 Protein 5e-47 51
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_013450.8614421.p0 Protein 5e-47 51
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_007793.3914279.p0 Protein 5e-47 51
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_002745.1124361.p0 Protein 5e-47 51
Dhaf_4050 YP_002460496.1 transcriptional regulator HE999704.1.gene2815. Protein 1e-48 51
Dhaf_4050 YP_002460496.1 transcriptional regulator AE000516.2.gene3505. Protein 2e-43 50
Dhaf_4050 YP_002460496.1 transcriptional regulator AE016830.1.gene1681. Protein 6e-47 49
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_012469.1.7686381. Protein 2e-41 47
Dhaf_4050 YP_002460496.1 transcriptional regulator CP004022.1.gene3215. Protein 5e-29 43
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_014475.1.orf0.gen Protein 7e-36 43
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_005054.2598277.p0 Protein 7e-36 43
Dhaf_4050 YP_002460496.1 transcriptional regulator BAC0039 Protein 3e-36 43
Dhaf_4050 YP_002460496.1 transcriptional regulator CP000647.1.gene2531. Protein 2e-36 43
Dhaf_4050 YP_002460496.1 transcriptional regulator BAC0596 Protein 5e-35 43
Dhaf_4050 YP_002460496.1 transcriptional regulator CP000034.1.gene2186. Protein 3e-36 43
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_002695.1.916589.p Protein 3e-36 43
Dhaf_4050 YP_002460496.1 transcriptional regulator CP001138.1.gene2239. Protein 5e-35 43
Dhaf_4050 YP_002460496.1 transcriptional regulator AE015929.1.gene1106. Protein 2e-27 42
Dhaf_4050 YP_002460496.1 transcriptional regulator BAC0125 Protein 1e-28 42
Dhaf_4050 YP_002460496.1 transcriptional regulator AF155139.2.orf0.gene Protein 1e-37 42
Dhaf_4050 YP_002460496.1 transcriptional regulator CP001485.1.gene721.p Protein 1e-26 42
Dhaf_4050 YP_002460496.1 transcriptional regulator CP001918.1.gene3444. Protein 1e-35 42
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_007622.3794948.p0 Protein 3e-29 41
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_003923.1003417.p0 Protein 3e-29 41
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_013450.8614146.p0 Protein 3e-29 41
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_002951.3238224.p0 Protein 3e-29 41
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_007793.3914065.p0 Protein 3e-29 41
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_002758.1121390.p0 Protein 3e-29 41
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_010079.5776364.p0 Protein 3e-29 41
Dhaf_4050 YP_002460496.1 transcriptional regulator NC_002952.2859858.p0 Protein 3e-29 41
Dhaf_4050 YP_002460496.1 transcriptional regulator FJ349556.1.orf0.gene Protein 7e-38 41
Dhaf_4050 YP_002460496.1 transcriptional regulator AM180355.1.gene1830. Protein 6e-33 41
Dhaf_4050 YP_002460496.1 transcriptional regulator CP001581.1.gene280.p Protein 5e-31 41
Dhaf_4050 YP_002460496.1 transcriptional regulator CP000034.1.gene3671. Protein 1e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dhaf_4050 YP_002460496.1 transcriptional regulator VFG1563 Protein 4e-35 44
Dhaf_4050 YP_002460496.1 transcriptional regulator VFG1702 Protein 1e-35 44
Dhaf_4050 YP_002460496.1 transcriptional regulator VFG1390 Protein 1e-31 42
Dhaf_4050 YP_002460496.1 transcriptional regulator VFG0596 Protein 2e-28 41