Gene Information

Name : Dhaf_3739 (Dhaf_3739)
Accession : YP_002460191.1
Strain : Desulfitobacterium hafniense DCB-2
Genome accession: NC_011830
Putative virulence/resistance : Resistance
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3976964 - 3977656 bp
Length : 693 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bha:BH1580 two-component response regulator

DNA sequence :
ATGAATGCGATTTTAGTAATTGATGATGAAGAACGTATACGTCATTTGGTTCGCATGTATTTGGAACGGGAAGGCTATGA
GGTGGATGAAGCAGGCAATGGGCGGGAAGCTCTGGAAAAGTTTCAGAAACAGGACTATGCTCTGCTGATCGTCGATTTAA
TGATGCCTGAGATAGATGGCTGGAAAGTATGCCGGGATGTGAGAGAGAGATCCGATATCCCGATCATAATGCTCACAGCC
CGAGGGGAAGAGTTTGATCGTGTGTTAGGTTTTGAATTGGGCGCAGATGATTATCTCGTGAAACCATTTAGCACCAAGGA
GCTGGTAGCGCGGGTAAAAGCGCTTTTAAGGCGTTCCCGGGGGAATACGGCCATAAGTTCTTCAGACTTACTCTTCGGTC
CCCTTAAAATTGAGAAGGATAAACATCGGGTGTCCATCGATGATGAACAAATTCCTTTTACGCCAAGGGAATTTGAGCTC
CTTTACTTTTTAGCCAAAAACCCCAGCCGGGTGTTTTCCAGAGAACAGCTGATGGAAACCGTATGGGGCTATGATTTCTA
TGGTGATGCCCGCACAGTGGATACTCATGTCAAGAAGATTCGTGAAAAGCTGGCTGACCCTAAAGTAAGGAGCATGCTTG
CTACGGTATGGGGAGTGGGCTATAAATTCGATCCCGAAGCAGTCAATGAATAG

Protein sequence :
MNAILVIDDEERIRHLVRMYLEREGYEVDEAGNGREALEKFQKQDYALLIVDLMMPEIDGWKVCRDVRERSDIPIIMLTA
RGEEFDRVLGFELGADDYLVKPFSTKELVARVKALLRRSRGNTAISSSDLLFGPLKIEKDKHRVSIDDEQIPFTPREFEL
LYFLAKNPSRVFSREQLMETVWGYDFYGDARTVDTHVKKIREKLADPKVRSMLATVWGVGYKFDPEAVNE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
nisR YP_006309898.1 NisR Not tested FWisland_1 Protein 2e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_012469.1.7685629. Protein 7e-49 48
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_002952.2859905.p0 Protein 2e-47 48
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_003923.1003749.p0 Protein 2e-47 48
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_002745.1124361.p0 Protein 2e-47 48
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_009782.5559369.p0 Protein 2e-47 48
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_002951.3237708.p0 Protein 2e-47 48
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_002758.1121668.p0 Protein 2e-47 48
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_007622.3794472.p0 Protein 2e-47 48
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_009641.5332272.p0 Protein 2e-47 48
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_013450.8614421.p0 Protein 2e-47 48
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_007793.3914279.p0 Protein 2e-47 48
Dhaf_3739 YP_002460191.1 transcriptional regulator HE999704.1.gene2815. Protein 1e-46 45
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_012469.1.7686381. Protein 2e-47 44
Dhaf_3739 YP_002460191.1 transcriptional regulator AF155139.2.orf0.gene Protein 3e-47 44
Dhaf_3739 YP_002460191.1 transcriptional regulator FJ349556.1.orf0.gene Protein 9e-46 44
Dhaf_3739 YP_002460191.1 transcriptional regulator AE000516.2.gene3505. Protein 2e-38 43
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_010400.5986590.p0 Protein 2e-40 42
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_011595.7057856.p0 Protein 3e-41 42
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_010410.6002989.p0 Protein 3e-41 42
Dhaf_3739 YP_002460191.1 transcriptional regulator HE999704.1.gene1528. Protein 3e-33 41
Dhaf_3739 YP_002460191.1 transcriptional regulator NC_002695.1.915041.p Protein 2e-30 41
Dhaf_3739 YP_002460191.1 transcriptional regulator CP000034.1.gene3834. Protein 2e-30 41
Dhaf_3739 YP_002460191.1 transcriptional regulator CP001138.1.gene4273. Protein 2e-30 41
Dhaf_3739 YP_002460191.1 transcriptional regulator CP004022.1.gene3215. Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dhaf_3739 YP_002460191.1 transcriptional regulator VFG1389 Protein 1e-33 45