|
Name : Dhaf_3726 (Dhaf_3726) Accession : YP_002460178.1 Strain : Desulfitobacterium hafniense DCB-2 Genome accession: NC_011830 Putative virulence/resistance : Resistance Product : copper ion binding protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 3960582 - 3960776 bp Length : 195 bp Strand : - Note : TIGRFAM: copper ion binding protein; PFAM: Heavy metal transport/detoxification protein; KEGG: ttj:TTHA1718 heavy metal binding protein DNA sequence : ATGAATCAAACCTTAAAAGTTACCGGAATGACCTGCAATCATTGCAAAGCCCATGTGGAAAAAGCCTTGCTGAAAGTGGG CGGAGTCCAACAGGTAGATGTGAATTTAGAAAAAGGAGAAGCAGTAGTCGCCGGATCAGCCGGACGGGAAGAGCTGATTA AAGCTGTGGAAGACGCCGGTTATAACGCTGAGTGA Protein sequence : MNQTLKVTGMTCNHCKAHVEKALLKVGGVQQVDVNLEKGEAVVAGSAGREELIKAVEDAGYNAE |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 4e-08 | 52 |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 4e-08 | 52 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 4e-08 | 52 |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 4e-08 | 52 |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 4e-08 | 52 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 6e-08 | 52 |
| unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 2e-08 | 47 |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 1e-07 | 46 |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 2e-07 | 46 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Dhaf_3726 | YP_002460178.1 | copper ion binding protein | BAC0679 | Protein | 9e-08 | 47 |
| Dhaf_3726 | YP_002460178.1 | copper ion binding protein | BAC0231 | Protein | 3e-08 | 47 |
| Dhaf_3726 | YP_002460178.1 | copper ion binding protein | BAC0678 | Protein | 7e-08 | 46 |
| Dhaf_3726 | YP_002460178.1 | copper ion binding protein | BAC0085 | Protein | 4e-04 | 41 |
| Dhaf_3726 | YP_002460178.1 | copper ion binding protein | BAC0675 | Protein | 2e-06 | 41 |
