Gene Information

Name : Dhaf_3726 (Dhaf_3726)
Accession : YP_002460178.1
Strain : Desulfitobacterium hafniense DCB-2
Genome accession: NC_011830
Putative virulence/resistance : Resistance
Product : copper ion binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 3960582 - 3960776 bp
Length : 195 bp
Strand : -
Note : TIGRFAM: copper ion binding protein; PFAM: Heavy metal transport/detoxification protein; KEGG: ttj:TTHA1718 heavy metal binding protein

DNA sequence :
ATGAATCAAACCTTAAAAGTTACCGGAATGACCTGCAATCATTGCAAAGCCCATGTGGAAAAAGCCTTGCTGAAAGTGGG
CGGAGTCCAACAGGTAGATGTGAATTTAGAAAAAGGAGAAGCAGTAGTCGCCGGATCAGCCGGACGGGAAGAGCTGATTA
AAGCTGTGGAAGACGCCGGTTATAACGCTGAGTGA

Protein sequence :
MNQTLKVTGMTCNHCKAHVEKALLKVGGVQQVDVNLEKGEAVVAGSAGREELIKAVEDAGYNAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 4e-08 52
merP AFG30122.1 MerP Not tested PAGI-2 Protein 4e-08 52
merP AGK07023.1 MerP Not tested SGI1 Protein 4e-08 52
merP AGK07081.1 MerP Not tested SGI1 Protein 4e-08 52
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 6e-08 52
merP ABQ57373.1 MerP Not tested SGI1 Protein 4e-08 52
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 2e-08 47
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-07 46
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-07 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dhaf_3726 YP_002460178.1 copper ion binding protein BAC0679 Protein 9e-08 47
Dhaf_3726 YP_002460178.1 copper ion binding protein BAC0231 Protein 3e-08 47
Dhaf_3726 YP_002460178.1 copper ion binding protein BAC0678 Protein 7e-08 46
Dhaf_3726 YP_002460178.1 copper ion binding protein BAC0085 Protein 4e-04 41
Dhaf_3726 YP_002460178.1 copper ion binding protein BAC0675 Protein 2e-06 41