Gene Information

Name : Dhaf_1673 (Dhaf_1673)
Accession : YP_002458155.1
Strain : Desulfitobacterium hafniense DCB-2
Genome accession: NC_011830
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1790101 - 1790802 bp
Length : 702 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bcy:Bcer98_0264 two component transcriptional regulator

DNA sequence :
ATGACAAAAGAAAAAATTCTGATCGCCGACGATGAGGTGGAGCTTGCGGAACTGGTCAAAGACTTTTTAAGCGACGAACA
GTATGAGGCTTTGGTCGCCAGGGATGGTCATGAGGCCCTGGAGCTGTTCAGGATGAACCAGCCCCAGCTGGTGATTCTGG
ATATCATGATGCCCGGCCTTGATGGGATGGAGGTCTGCCGGAGGATCCGCGCCGAATCCAATGTCCCCATCATCATGTTA
AGCGCGAAAAAGGCCGAGGTGGATAAAATCCTCGGCTTGGGACTGGGGGCGGACGACTATATTGTCAAGCCCTTCAGCCC
CGGTGAAGTGGTGGCCAGGGTGAAGGCTCAATTGCGCAGATTCAAGATGAGCGCTGTTCCCGAGCCCAAAACCCGGCTCT
TGTCATACAGCGGTCTGGAAATTGATGTGCAGGGGTATGAGGCGGCCTTGGCCGGCCGTCCTCTGGAGCTGACCACCAAA
GAATTCGAATTGCTGCGGTTTCTGGCCCTGCACCCCAATCAGGTCTTGACCCGGGAGCAAATTTTTGCCAATGTTTGGGG
GTTTAATGAAAGCGGTGATTTAAATACCGTGACCGTCCACATTAAGAAACTGAGAGAAAAAATCGAATCGGACCTCGCCA
ATCCCACATTTATCAAAACCGTTTGGGGCGTGGGCTACAAGTTCAGTGGAGGGGCAAAATGA

Protein sequence :
MTKEKILIADDEVELAELVKDFLSDEQYEALVARDGHEALELFRMNQPQLVILDIMMPGLDGMEVCRRIRAESNVPIIML
SAKKAEVDKILGLGLGADDYIVKPFSPGEVVARVKAQLRRFKMSAVPEPKTRLLSYSGLEIDVQGYEAALAGRPLELTTK
EFELLRFLALHPNQVLTREQIFANVWGFNESGDLNTVTVHIKKLREKIESDLANPTFIKTVWGVGYKFSGGAK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-39 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dhaf_1673 YP_002458155.1 transcriptional regulator AF155139.2.orf0.gene Protein 2e-48 50
Dhaf_1673 YP_002458155.1 transcriptional regulator NC_014475.1.orf0.gen Protein 2e-50 49
Dhaf_1673 YP_002458155.1 transcriptional regulator NC_005054.2598277.p0 Protein 2e-50 49
Dhaf_1673 YP_002458155.1 transcriptional regulator NC_012469.1.7685629. Protein 5e-46 49
Dhaf_1673 YP_002458155.1 transcriptional regulator FJ349556.1.orf0.gene Protein 6e-45 47
Dhaf_1673 YP_002458155.1 transcriptional regulator NC_002952.2859905.p0 Protein 8e-44 47
Dhaf_1673 YP_002458155.1 transcriptional regulator NC_002745.1124361.p0 Protein 8e-44 47
Dhaf_1673 YP_002458155.1 transcriptional regulator NC_009782.5559369.p0 Protein 8e-44 47
Dhaf_1673 YP_002458155.1 transcriptional regulator NC_002951.3237708.p0 Protein 8e-44 47
Dhaf_1673 YP_002458155.1 transcriptional regulator NC_007622.3794472.p0 Protein 8e-44 47
Dhaf_1673 YP_002458155.1 transcriptional regulator NC_002758.1121668.p0 Protein 8e-44 47
Dhaf_1673 YP_002458155.1 transcriptional regulator NC_009641.5332272.p0 Protein 8e-44 47
Dhaf_1673 YP_002458155.1 transcriptional regulator NC_013450.8614421.p0 Protein 8e-44 47
Dhaf_1673 YP_002458155.1 transcriptional regulator NC_003923.1003749.p0 Protein 8e-44 47
Dhaf_1673 YP_002458155.1 transcriptional regulator NC_007793.3914279.p0 Protein 8e-44 47
Dhaf_1673 YP_002458155.1 transcriptional regulator NC_012469.1.7686381. Protein 7e-42 45
Dhaf_1673 YP_002458155.1 transcriptional regulator AF130997.1.orf0.gene Protein 2e-41 45
Dhaf_1673 YP_002458155.1 transcriptional regulator AM180355.1.gene1830. Protein 2e-44 45
Dhaf_1673 YP_002458155.1 transcriptional regulator AE000516.2.gene3505. Protein 9e-43 45
Dhaf_1673 YP_002458155.1 transcriptional regulator HE999704.1.gene2815. Protein 4e-43 45
Dhaf_1673 YP_002458155.1 transcriptional regulator DQ212986.1.gene4.p01 Protein 2e-42 44
Dhaf_1673 YP_002458155.1 transcriptional regulator CP001918.1.gene3444. Protein 6e-40 42
Dhaf_1673 YP_002458155.1 transcriptional regulator CP000034.1.gene2186. Protein 8e-40 42
Dhaf_1673 YP_002458155.1 transcriptional regulator BAC0596 Protein 4e-41 42
Dhaf_1673 YP_002458155.1 transcriptional regulator BAC0039 Protein 8e-40 42
Dhaf_1673 YP_002458155.1 transcriptional regulator CP001138.1.gene2239. Protein 4e-41 42
Dhaf_1673 YP_002458155.1 transcriptional regulator NC_002695.1.916589.p Protein 6e-40 42
Dhaf_1673 YP_002458155.1 transcriptional regulator AE015929.1.gene1106. Protein 3e-34 41
Dhaf_1673 YP_002458155.1 transcriptional regulator AE016830.1.gene1681. Protein 6e-41 41
Dhaf_1673 YP_002458155.1 transcriptional regulator AF162694.1.orf4.gene Protein 7e-39 41
Dhaf_1673 YP_002458155.1 transcriptional regulator CP000647.1.gene2531. Protein 3e-39 41
Dhaf_1673 YP_002458155.1 transcriptional regulator CP004022.1.gene1676. Protein 1e-37 41
Dhaf_1673 YP_002458155.1 transcriptional regulator AF253562.2.orf0.gene Protein 4e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dhaf_1673 YP_002458155.1 transcriptional regulator VFG1563 Protein 1e-39 42
Dhaf_1673 YP_002458155.1 transcriptional regulator VFG1389 Protein 3e-30 42
Dhaf_1673 YP_002458155.1 transcriptional regulator VFG1702 Protein 1e-38 41