|
Name : BCG9842_B2804 (BCG9842_B2804) Accession : YP_002445916.1 Strain : Bacillus cereus G9842 Genome accession: NC_011772 Putative virulence/resistance : Unknown Product : 1-related, transposase Function : - COG functional category : - COG ID : - EC number : - Position : 2403959 - 2404096 bp Length : 138 bp Strand : - Note : an automated process has identified a potential problem with this gene model; the current end5 and/or the end3 may need to extended or the current gene model may need to be merged with a neighboring gene model; the current gene model (or a revised gene mo DNA sequence : TTGAAGACAAGAGTTCATTACCCAGAAGAAGTAAAGTGGAAAGTGATTGAAATGAAAAAGGATGGATATTCCAATTGGAC AATTATGGAGAAGCTTGGAATTAAAAATGTTTCCCAAATTAAGACGTGGATGAAGTAG Protein sequence : MKTRVHYPEEVKWKVIEMKKDGYSNWTIMEKLGIKNVSQIKTWMK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SE0100 | NP_763655.1 | transposase | Not tested | SCCpbp4 | Protein | 2e-04 | 50 |
