Gene Information

Name : pmrA (PLES_51611)
Accession : YP_002442740.1
Strain : Pseudomonas aeruginosa LESB58
Genome accession: NC_011770
Putative virulence/resistance : Virulence
Product : PmrA: two-component regulator system response regulator PmrA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5697993 - 5698658 bp
Length : 666 bp
Strand : +
Note : -

DNA sequence :
ATGAGAATACTGCTGGCCGAGGACGACCTGCTGCTCGGCGACGGCATCCGCGCCGGGCTGCGCCTGGAAGGCGATACCGT
GGAATGGGTGACCGACGGCGTGGCCGCGGAGAACGCGCTGGTCACCGACGAGTTCGACCTGCTGGTGCTCGACATCGGAC
TGCCGCGCCGCAGCGGCCTGGACATCCTGCGTAACCTGCGCCACCAGGGCCGGCTCACCCCGGTGCTGCTGCTCACCGCG
CGGGACAAGGTGGCCGACCGGGTCGCCGGGCTCGACAGCGGTGCCGACGACTACCTGACCAAGCCCTTCTATCTCGACGA
ACTGCAGGCACGGGTGCGCGCCCTGACCCGCCGCACCACCGGTCGCGCCCTGCCGCAACTGGTGCACGGCGAGCTGCGCC
TGGACCCGGCGACCCACCAAGTGACCCTGTCCGGGCAGGCGGTGGAACTGGCGCCGCGCGAATACGCACTGCTGCGCCTG
CTGCTGGAGAACAGCGGCAAGGTGCTCTCGCGCAACCAACTGGAGCAGAGCCTCTACGGCTGGAGCGGCGACGTCGAGAG
CAACGCCATCGAAGTCCACGTCCACCACCTGCGGCGCAAGCTCGGCAACCAGTTGATCCGCACCGTCCGCGGCATCGGCT
ACGGCATCGACCAGCCGGCGCCCTGA

Protein sequence :
MRILLAEDDLLLGDGIRAGLRLEGDTVEWVTDGVAAENALVTDEFDLLVLDIGLPRRSGLDILRNLRHQGRLTPVLLLTA
RDKVADRVAGLDSGADDYLTKPFYLDELQARVRALTRRTTGRALPQLVHGELRLDPATHQVTLSGQAVELAPREYALLRL
LLENSGKVLSRNQLEQSLYGWSGDVESNAIEVHVHHLRRKLGNQLIRTVRGIGYGIDQPAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-29 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pmrA YP_002442740.1 PmrA: two-component regulator system response regulator PmrA BAC0487 Protein 1e-30 45
pmrA YP_002442740.1 PmrA: two-component regulator system response regulator PmrA NC_002516.2.879194.p Protein 4e-21 42
pmrA YP_002442740.1 PmrA: two-component regulator system response regulator PmrA BAC0308 Protein 7e-23 41
pmrA YP_002442740.1 PmrA: two-component regulator system response regulator PmrA NC_010079.5776364.p0 Protein 3e-23 41
pmrA YP_002442740.1 PmrA: two-component regulator system response regulator PmrA NC_002952.2859858.p0 Protein 3e-23 41
pmrA YP_002442740.1 PmrA: two-component regulator system response regulator PmrA NC_007622.3794948.p0 Protein 3e-23 41
pmrA YP_002442740.1 PmrA: two-component regulator system response regulator PmrA NC_003923.1003417.p0 Protein 3e-23 41
pmrA YP_002442740.1 PmrA: two-component regulator system response regulator PmrA NC_013450.8614146.p0 Protein 3e-23 41
pmrA YP_002442740.1 PmrA: two-component regulator system response regulator PmrA NC_002951.3238224.p0 Protein 3e-23 41
pmrA YP_002442740.1 PmrA: two-component regulator system response regulator PmrA NC_007793.3914065.p0 Protein 3e-23 41
pmrA YP_002442740.1 PmrA: two-component regulator system response regulator PmrA NC_002758.1121390.p0 Protein 3e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pmrA YP_002442740.1 PmrA: two-component regulator system response regulator PmrA VFG0473 Protein 2e-33 46
pmrA YP_002442740.1 PmrA: two-component regulator system response regulator PmrA VFG1390 Protein 3e-29 43