|
Name : rpmE2 (PLES_14341) Accession : YP_002439038.1 Strain : Pseudomonas aeruginosa LESB58 Genome accession: NC_011770 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0254 EC number : - Position : 1544283 - 1544546 bp Length : 264 bp Strand : + Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g DNA sequence : ATGAAACCCGGCATCCATCCCGAATACCGTCCCGTCCTGTTCCATGACACCTCGGCCGACGTGTACTTCCTGATCGGCTC CACCGCGGAGACCGACAAGACCCATACCCATACCGACGGCAAGACCTATCCCTACGTGACGCTGGACGTTTCCAGCGCCT CGCACCCGGTCTACACCGGCGAACAGCGCAAGACCAAGAGCGAAGGCCGCGTGGCCGGGTTCAACAAGCGTTTCGCCGGC TTCGTCGGCGGCAAGGGGGCCTGA Protein sequence : MKPGIHPEYRPVLFHDTSADVYFLIGSTAETDKTHTHTDGKTYPYVTLDVSSASHPVYTGEQRKTKSEGRVAGFNKRFAG FVGGKGA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 2e-15 | 60 |
| rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 2e-15 | 60 |
