Gene Information

Name : DvMF_0882 (DvMF_0882)
Accession : YP_002435306.1
Strain : Desulfovibrio vulgaris Miyazaki F
Genome accession: NC_011769
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1064865 - 1065557 bp
Length : 693 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: dde:Dde_2387 two component transcriptional regulator

DNA sequence :
ATGACGAAAGAGCGCATTCTGGTGGTGGAAGACGACGAGGACATCCTGCAGTTGCTGACCTTCACCTTCGAATCCGCCGG
GTTCGAAGTGCGCACGGCCACCACGGGGCGAGAAGGTCTGGAGATCGCGCTGCGCCAGAAGCCCGCGCTGGTTCTGCTGG
ACCTGATGCTGCCCGGCATGAGCGGCCTTGACGTGTGCCGCGAACTGAAGCGCATGCCGGAAACGGAAGACGTGCCGGTG
ATCATGCTCACCGCGCGCGGCGAGGAAGTGGACCGCATCGTGGGGCTGGAACTGGGCGCCGACGACTACGTGGTCAAGCC
CTTCAGCCCGCGCGAACTGGTGCTGCGCATCCGTGCCGTGCTCAAGCGCGCGCAGGGCGTGGCCGAAAACCCCCAGCGCT
CGCAGTGGCAGATCGACGGGCTGGCCCTGGACCTGGACGCGCACCGGGTGGAGGTGGACGGCGAGGAAGCCGCCCTGACC
GCCACCGAATTCCGCCTGCTGGCGGAACTGGTGCGCAACCGGGGCCGCGTGCGCACCCGCGACCAGCTGCTGAACACGGT
GTGGGGCTACGAGTTCGAGGGGTACGCCCGCACGGTGGATACCCACGTGCGCAGGCTGCGCCAGAAGATCGGCGGCTACG
CGGCCATGATCGAAACCATCCGGGGCGTGGGATACCGCTTCAAGGAACAGTAG

Protein sequence :
MTKERILVVEDDEDILQLLTFTFESAGFEVRTATTGREGLEIALRQKPALVLLDLMLPGMSGLDVCRELKRMPETEDVPV
IMLTARGEEVDRIVGLELGADDYVVKPFSPRELVLRIRAVLKRAQGVAENPQRSQWQIDGLALDLDAHRVEVDGEEAALT
ATEFRLLAELVRNRGRVRTRDQLLNTVWGYEFEGYARTVDTHVRRLRQKIGGYAAMIETIRGVGYRFKEQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-36 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-47 49
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-42 45
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 7e-44 44
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 7e-44 44
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 6e-44 44
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 6e-44 44
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 6e-44 44
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 6e-44 44
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 7e-44 44
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 6e-44 44
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 6e-44 44
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 6e-44 44
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 3e-36 42
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 3e-36 42
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 2e-36 42
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_008702.1.4607594. Protein 2e-38 42
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 1e-25 42
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-42 41
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-42 41
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-42 41
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-42 41
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-42 41
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-42 41
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-42 41
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-42 41
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 6e-46 41
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-33 41
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family BAC0197 Protein 2e-30 41
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 4e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family VFG1563 Protein 8e-37 41
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family VFG1702 Protein 5e-36 41
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family VFG1386 Protein 4e-36 41
DvMF_0882 YP_002435306.1 two component transcriptional regulator, winged helix family VFG1389 Protein 5e-32 41