Gene Information

Name : Dalk_1128 (Dalk_1128)
Accession : YP_002430299.1
Strain : Desulfatibacillum alkenivorans AK-01
Genome accession: NC_011768
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1501278 - 1501982 bp
Length : 705 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: afw:Anae109_0880 two component transcriptional regulator

DNA sequence :
ATGGAACAAGCATTGATCAACATCCTGATGATCGAAGACGACCAGCGGCTGGCCAAGCTCACCCAGGAGTACCTGGAGCG
CAACGGCTTGGCCGTCTCCCTTTCCGGAGATGGAGAAGCCGGGCTTCAGCAGGCCTTGCAACACCGATTCGACGCCATCG
TGCTGGACCTCATGCTGCCGGCGCGCGACGGAATTTCCGTGTGCCAGCGCATCCGGGAGCATTCCGACGCCCCCATCATC
ATGGTCACGGCCAGGGGCGAGGAAGCCGACCGGGTCATGGGCCTGGAGATCGGCGCGGACGACTATCTGCCCAAGCCCTT
TTCCCCCAGGGAATTGCTCGCCCGCATAAGGGCCATGGTCCGCCGGGCCAGGGGCCAGGCAGGCCCCCGCAGCTCCGTGG
TGGTCGTGGGCGATCTCATGCTGGACCCCGCCGCCCTCACCGCCGTGTTGGACGGCGCCCCTCTGGACTTGACCACCTAC
GAGTTCGCCCTGCTAAAGGCCCTGGCGGAACGGGCCGGCCAGGTTCTCTCCCGGGAGCGTCTGATGGAGCTTGCCAAGGG
CAACGCCGAGGAGGCTTTCGACCGGTCCATTGACGTGCATATTTCCCGGCTGCGGCAAAAAATCGGGGACGATCCCCGTC
ACCCCACACGAATCCGCACGGTGCGCGGAGCAGGATACCAATACCTCAGCCGAGGAAACTCATGA

Protein sequence :
MEQALINILMIEDDQRLAKLTQEYLERNGLAVSLSGDGEAGLQQALQHRFDAIVLDLMLPARDGISVCQRIREHSDAPII
MVTARGEEADRVMGLEIGADDYLPKPFSPRELLARIRAMVRRARGQAGPRSSVVVVGDLMLDPAALTAVLDGAPLDLTTY
EFALLKALAERAGQVLSRERLMELAKGNAEEAFDRSIDVHISRLRQKIGDDPRHPTRIRTVRGAGYQYLSRGNS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-29 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 7e-46 47
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 2e-40 47
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 1e-47 47
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 1e-33 46
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 6e-43 45
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 4e-44 45
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 3e-37 44
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 3e-37 44
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 2e-36 44
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 8e-41 44
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator BAC0533 Protein 2e-36 43
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 2e-36 43
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 7e-41 42
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-39 42
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 4e-36 42
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 2e-36 42
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator BAC0596 Protein 2e-36 42
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-38 41
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 8e-38 41
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-38 41
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 6e-35 41
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator BAC0039 Protein 3e-36 41
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 3e-36 41
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 3e-36 41
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-27 43
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator VFG0473 Protein 1e-23 42
Dalk_1128 YP_002430299.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-29 41