Gene Information

Name : AFE_2938 (AFE_2938)
Accession : YP_002427305.1
Strain : Acidithiobacillus ferrooxidans ATCC 23270
Genome accession: NC_011761
Putative virulence/resistance : Unknown
Product : ISAfe4, transposase orf2
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 2626963 - 2627310 bp
Length : 348 bp
Strand : -
Note : identified by match to protein family HMM PF05717

DNA sequence :
ATGTGGCTAAATTCGAGCAGCCGGATCTGGCTCGCGGCAGCGCCCGTGGATATGCGCTTGGGCTTTGATGGCCTGGCGGC
TAAGGTGCAGGGGGTATTGGCTGCCGATCCTTTTTGCGGTCATGCTTTTGTCTTTCGCAACCGCCGGGGGGATCGTCTGA
AATTGTTACTGTGGGATGGACTGGGTTTCTGGCTGGTGTATCGCCGTCTGGATCAGGGACGACTCCATTGGCCCCGCGCC
GATGCCGGTGCCCTGGAACTCTCCGCTGCGCAGTGGGCGATGCTGGTAGAGGGGCGCCCGTGGACGCCGTTACCGACCTT
GGAAAAATGCACACCAAAACTGCTGTAA

Protein sequence :
MWLNSSSRIWLAAAPVDMRLGFDGLAAKVQGVLAADPFCGHAFVFRNRRGDRLKLLLWDGLGFWLVYRRLDQGRLHWPRA
DAGALELSAAQWAMLVEGRPWTPLPTLEKCTPKLL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 4e-21 55
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-18 52
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-18 52
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-18 52
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-18 52
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-18 52
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-18 52
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-18 52
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-18 52
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-18 52
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-18 52
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-17 51
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-17 51
unnamed AAL08461.1 unknown Not tested SRL Protein 8e-18 51
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-14 50
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 5e-20 48
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-20 48
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-19 47
RL060 AAP84185.1 transposase Not tested PAPI-1 Protein 4e-15 47
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 6e-17 47
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 6e-17 47
unnamed ABR13518.1 transposase Not tested PAGI-7 Protein 3e-15 46
EXB18 ABD94704.1 ISPpu14 transposase Orf2 Not tested ExoU island B Protein 2e-15 46
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-16 45
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-16 45
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-15 44
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-15 44
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-16 44
tnpB AEZ06052.1 transposition helper protein Not tested Tn6167 Protein 1e-14 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AFE_2938 YP_002427305.1 ISAfe4, transposase orf2 VFG1709 Protein 1e-18 52
AFE_2938 YP_002427305.1 ISAfe4, transposase orf2 VFG0792 Protein 1e-18 52
AFE_2938 YP_002427305.1 ISAfe4, transposase orf2 VFG1698 Protein 8e-19 52
AFE_2938 YP_002427305.1 ISAfe4, transposase orf2 VFG1052 Protein 3e-18 51
AFE_2938 YP_002427305.1 ISAfe4, transposase orf2 VFG1517 Protein 5e-15 50
AFE_2938 YP_002427305.1 ISAfe4, transposase orf2 VFG1665 Protein 5e-20 47
AFE_2938 YP_002427305.1 ISAfe4, transposase orf2 VFG1737 Protein 3e-17 44