Gene Information

Name : AFE_1610 (AFE_1610)
Accession : YP_002426033.1
Strain : Acidithiobacillus ferrooxidans ATCC 23270
Genome accession: NC_011761
Putative virulence/resistance : Unknown
Product : ISAfe7, transposase orfA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1388762 - 1389091 bp
Length : 330 bp
Strand : -
Note : identified by match to protein family HMM PF01527

DNA sequence :
ATGAACAAAGCTAAAACACCCAAATATTCCCCTGAAGTTCGCGAACGCGCGGTGCGCATGGTGCAGGAACACCGCGGCGA
GTATTCTTCGCCCTGGGCGGCGGTGGAGTCTATTGCTCCTAAGATCGGCTGTTCGCCCCATACCTTGCATGAATGGGTTA
AACGGCATGAAGTCGATACCGGATTGCGCGACGGCGTCACCAGCGAAGAGTGTGAACGTATCAAGGCGCTGGAGCGTGAG
GTCAAGGAATTGCGCCGTGCCAACGAAATCCTGAAGCTGGCAAGTGCGTTTTTTGCCCAGGCGGAGCTCGACCGCCGTCT
GAAGTCATGA

Protein sequence :
MNKAKTPKYSPEVRERAVRMVQEHRGEYSSPWAAVESIAPKIGCSPHTLHEWVKRHEVDTGLRDGVTSEECERIKALERE
VKELRRANEILKLASAFFAQAELDRRLKS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 2e-25 63
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 2e-25 63
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 2e-25 63
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 2e-25 63
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 5e-25 61
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 2e-23 61
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 5e-25 61
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 2e-23 61
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 5e-25 61
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 2e-23 61
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 5e-25 61
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 8e-25 61
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 2e-22 59
unnamed AAF09023.1 unknown Not tested SHI-O Protein 2e-22 59
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 7e-22 58
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 8e-21 58
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 4e-21 58
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 2e-21 58
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 5e-22 58
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 7e-22 58
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-22 58
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 7e-22 58
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 7e-22 58
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 8e-20 57
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 5e-20 57
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 8e-20 56
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 5e-20 56
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 8e-20 56
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 5e-20 56
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 8e-20 56
CDCE8392_1959 YP_005134490.1 hypothetical protein Not tested Not named Protein 1e-11 44
CDC7B_2036 YP_005163477.1 hypothetical protein Not tested Not named Protein 1e-10 43
DIP0242 NP_938632.1 IS element transposase Not tested Not named Protein 6e-10 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AFE_1610 YP_002426033.1 ISAfe7, transposase orfA VFG1603 Protein 2e-21 58
AFE_1610 YP_002426033.1 ISAfe7, transposase orfA VFG0643 Protein 2e-22 58
AFE_1610 YP_002426033.1 ISAfe7, transposase orfA VFG0606 Protein 7e-22 58
AFE_1610 YP_002426033.1 ISAfe7, transposase orfA VFG1717 Protein 2e-20 56