Name : sohA (AFE_1413) Accession : YP_002425842.1 Strain : Acidithiobacillus ferrooxidans ATCC 23270 Genome accession: NC_011761 Putative virulence/resistance : Unknown Product : regulator PrlF Function : - COG functional category : K : Transcription COG ID : COG2002 EC number : - Position : 1223629 - 1223958 bp Length : 330 bp Strand : - Note : SohA; PrlF; involved in protein secretion; when overproduced or mutated, it induces growth defect and increased export of a reporter protein; a PrlF mutation induces the activity of the Lon protease, and a Lon-deficient strain suppresses the phenotype con DNA sequence : ATGGCTGCCACCCTCGAAGTCGAATCCACGCTGACTGACCGCTACCAAACCACGGTGCCGGAGACCGTCCGCCGGGCCCT CCGGCTGGGCAAGCGCGACAAGATCCACTACACCATCCGCCCCGGTGGCGAGGTCGTGCTGACGCGCGCCGAGGACTCCG AGGAAGACGATCCGGTGCTCGGTCAGTTCCTGGGCTTCCTGGCCCGCGACATCGCCACGCATCCAGAGCGCCTGCAGGCC ATCGATGTCAGCTTCGTGCAGCGCCTCCAATCGCTGACCGGCGGCATCGAAGTCGATCTCGATGCCCCCTTGTCTGCGGA CGATGAATGA Protein sequence : MAATLEVESTLTDRYQTTVPETVRRALRLGKRDKIHYTIRPGGEVVLTRAEDSEEDDPVLGQFLGFLARDIATHPERLQA IDVSFVQRLQSLTGGIEVDLDAPLSADDE |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ydcA | AAW83089.1 | YdcA | Not tested | GGI | Protein | 1e-13 | 41 |